Publications
Showing 1551 - 1600 of 1955 Results
Turn Page
- First Page
- Previous Page
- 1301-1350
- 1451-1500
- 1501-1550
- Sie sind auf Seite:1551-1600
- 1601-1650
- 1651-1700
- Last Page
- Next Page
- 1801-1850
-
SourceAuthor(s)
-
[Contribution to a conference proceedings]
Thermophysical and mechanical properties of Pyz thick thermal barrier coatings
In: Thermal Spray : Meeting the Challenges of the 21. Century ; Proceedings of the 15. International Thermal Spray Conference, 25.-29.5.1998, Nice, France / Coddet, C. Hrsg, 623-628, 1998Schwingel, D.
Taylor, R.
Haubold, T.
Wigren, J.
Gualco, C.
et al. -
[Contribution to a conference proceedings]
High kinetic energys in thermal spraying
In: Processing and Fabrication of Advanced Materials VI : Proceedings of a Symposium Organized by School of Mechanical & Production Engineering, Nanyang Technological University, Singapore / Khor, K. A. Hrsg, 1149-1160, 1998Lugscheider, E.
Remer, P.
Reymann, H.
Kyeck, S.
Sicking, R. -
[Contribution to a book, Contribution to a conference proceedings]
Investigation of mechanical properties of CrN-PVD thin films by naoindentation
In: Fundamentals of Nanoindentation and Nanotribology : Symposium held 13.-17.4.1998, San Francisco, California, USA / Moody, N. R. [u.a.] Hrsg, 1998Lugscheider, Erich
Knotek, O.
Barimani, Cyrus
Guerreiro, S.
Lake, M. -
[Contribution to a book, Contribution to a conference proceedings]
Process windows and properties of tungsten- and vanadium - oxides deposited by MSIP - PVD - process
In: Properties and Processing of Vapor-Deposited Coatings : Symposium held 30.11.-2.12.1998, Boston, Massachusetts, U.S.A. / [Symposium 00 Properties and Processing of Vapor-Deposited Coatings at the 1998 MRS Fall Meeting] / Johnson, R. N. [u.a.] Hrsg, 1998Knotek, Otto
Lugscheider, Erich
Bärwulf, Stephan
Barimani, Cyrus -
[Journal Article]
Plasma-Pulverauftragschweißen - Vergleich von Standard- und Hochleistungsprozeß
In: Schweissen und Schneiden, 50 (2), 96-101, 1998Lugscheider, Erich
Langer, G. -
Peterseim, J.
Elsing, R.
Deuerler, F. -
Lugscheider, E.
-
[Contribution to a conference proceedings, Journal Article]
Parameter studies on high-velocity oxy-fuel spraying of MCrAIY coatings
In: Thin solid films, ..., 1998Lugscheider, E.
Zhao, Lidong
Herbst, C. -
[Journal Article]
Parameter studies on high-velocity oxy-fuel spraying of MCrAIY coatings
In: Surface & coatings technology, 108/109, 16-23, 1998Lugscheider, E.
Zhao, Lidong
Herbst, C. -
[Contribution to a conference proceedings, Journal Article]
Magnetronsputtered hard material coatings on thermoplastic polymers for clean room applications
In: Thin solid films, ..., 1998Lugscheider, Erich
Bärwulf, Stephan
Barimani, Cyrus
Riester, M.
Hilgers, H. -
[Contribution to a conference proceedings, Journal Article]
Investigation of new arc PVD coatings in the system Ti-Hf-C-N
In: Thin solid films, ..., 145-145, 1998Lugscheider, E.
Knotek, O.
Zimmermann, H.
Stricker, S. -
[Contribution to a conference proceedings, Journal Article]
Corrosion tests of PVD coatings with die dressing used for Al high-pressure die-casting dies
In: Thin solid films, ..., 1998Lugscheider, Erich
Barimani, Cyrus
Guerreiro, S.
Bobzin, Kirsten -
[Journal Article]
Vergleich verschiedener Meßmethoden zur Bestimmung der Partikelgröße von Pulvern zum Plasmaspritzen
In: Schweissen und Schneiden, 50, 724-731, 1998Lugscheider, E.
Suk, H.-G.
Lee, H.-K. -
[Journal Article]
Beschichtungstechnologien entwickeln sich mit den Anforderungen: Über den Masseneinsatz entscheidet ein konsequent durchgeführtes Qualitätsmanagement
In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 7 (2), 12-13, 1998Lugscheider, E. -
[Journal Article]
Analysis of a-BxCy:Hz coatings with IBA techniques
In: Nuclear instruments & methods in physics research / Section B, Beam interactions with materials and atoms, 136/138, 258-262, 1998Lugscheider, Erich
Giorginis, G.
Persson, L.
Hult, M.
Siry, C. W.
et al. -
[Journal Article]
Innenbeschichtung von Aluminium Motorblöcken mittels PVD-Technik - Teil 1
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 89 (2), 40-42, 1998Lugscheider, Erich
Wolff, C. -
[Journal Article]
Processing, structure and tribological behaviour of TiC-reinforced plasma sprayed coatings
In: Wear, 220 (1), 34-50, 1998
[DOI: 10.1016/S0043-1648(98)00237-3]Economou, S.
de Bonte, Marc
Celis, Jean-Pierre
Smith, R. W.
Lugscheider, Erich -
[Journal Article]
Plasma-arc powder surfacing - comparison of standard and high-productivity processes
In: Schweissen und Schneiden, 50, E28-E31, 1998Lugscheider, Erich
Langer, G. -
[Contribution to a book, Journal Article]
Wie High-Tech Beschichtungen laufen lernen : Oberflächenmodifikation an Bauteilen für die Medizintechnik
In: RWTH-Themen : Berichte aus der Rheinisch-Westfälischen Technischen Hochschule Aachen, 1998, 40-42, 1998Kyeck, Sascha
Lake, Mark
Lugscheider, Erich -
[Journal Article]
High-speed flame-sprayed chromium coatings for wear and corrosion protection
In: Schweissen und Schneiden, 50, E36-E39, 1998Lugscheider, Erich
Reymann, H. -
[Journal Article]
Ceramic thermal barrier coatings deposited with the electron beam-physical vapour deposition technique
In: Surface & coatings technology, 98 (1/3), 1221-1227, 1998Lugscheider, Erich
Barimani, Cyrus
Döpper, G. -
[Journal Article]
Hochgeschwindigkeitsflammgespritzte Chromschichten zum Verschleiß- und Korrosionsschutz
In: Schweissen und Schneiden, 50 (1), 44-47, 1998Lugscheider, Erich
Reymann, H. -
[Journal Article]
Possibilities and limits of the characterization of wear resistant PVD coatings by photothermal spectroscopy
In: Surface & coatings technology, 98 (1/3), 971-975, 1998
[DOI: 10.1016/S0257-8972(97)00308-3]Hayn, G. v.
Knotek, O.
Lugscheider, Erich
Zimmermann, H.
Zimmermann, H. -
[Journal Article]
(Cr:Al)N coatings deposited by cathodic vacuum ARC evaporation
In: Surface & coatings technology, 98 (1/3), 1233-1239, 1998
[DOI: 10.1016/S0257-8972(97)00238-7]Lugscheider, Erich
Vetter, J.
Guerreiro, S. -
[Journal Article]
Heat-resistant active brazing of silicon-nitride. Part 2: Metallurgical characterization of the braze joints
In: Welding journal, 77 (Suppl.), 103-109, 1998Lugscheider, Erich
Tillmann, W.
Schlimbach, K.
Manter, C.
Indacochea, C. A. -
[Journal Article]
Comparison of different measuring methods for the determination of the particle size of powders for plasma spraying
In: Schweissen und Schneiden, 50, E219-E222, 1998Lugscheider, Erich
Suk, H.-G.
Lee, H.-K. -
[Journal Article]
On the thermoelectric performance of plasma spray-formed iron disilicide
In: Journal of materials science / Letters, 17, 1487-1490, 1998Lugscheider, Erich
Schilz, J.
Müller, E.
Schakenberg, K.
Ernst, H.
et al. -
[Journal Article]
Wear and cutting performance of coated microdrills
In: Surface & coatings technology, 107, 191-196, 1998Löffler, F. -
[Journal Article]
Corrosion tests of PVD coatings with die dressing used for Al high-pressure die-casting dies
In: Surface & coatings technology, 108/109, 408-412, 1998Lugscheider, Erich
Barimani, Cyrus
Guerreiro, S.
Bobzin, Kirsten -
[Journal Article]
Magnetron-sputtered hard material coatings on thermoplastic polymers for clean room applications
In: Surface & coatings technology, 108/109, 398-402, 1998Lugscheider, Erich
Bärwulf, Stephan
Barimani, Cyrus
Riester, C.
Hilgers, H. -
[Book, Report]
High temperature and acid corrosion of stainless steel : final report
In: EUR 18625 : Technical Steel Research - Properties and In-Service Performance, 1998Grewe, Hans
Lugscheider, Erich -
[Contribution to a conference proceedings, Journal Article]
Investigations on hard coated reamers in different lubricant free cutting operations
In: Surface & coatings technology, 90 (1/2), 172-177, 1997
[DOI: 10.1016/S0257-8972(96)03114-3]Lugscheider, Erich
Knotek, O.
Barimani, C.
Leyendecker, T.
Lemmer, O.
et al. -
[Contribution to a book, Contribution to a conference proceedings]
Numerische Untersuchungen an plasma-gespritzten Schichten
In: Innovationen für Gleitlager, Wälzlager, Dichtungen und Führungen : VDI-Werkstofftag '97 ; 13. Jahrestagung Neu-Ulm, 10. und 11. Juni 1997 / VDI-Gesellschaft Werkstofftechnik, 1997Elsing, Rainer
Machayekhi, B. -
[Contribution to a book, Contribution to a conference proceedings]
Corrosion and wear resistant ternary Cr-C-N coatings deposited by the arc PVD process for machining tools and machining parts
In: Advanced materials-97 : [proceedings of the 5th International Symposium on Advanced Materials, 21 - 25th September, 1997, Islamabad, Pakistan] / organized and publ. by: A. Q. Khan Research Laboratories. Ed.: M. Afzal Khan ..., 478-485, 1997Knotek, Otto
Lugscheider, Erich
Zimmermann, Harald
Bobzin, Kirsten -
[Proceedings]
Innovative Werkstofftechnologie 1996: 4. Werkstoffwissenschaftliches Koll
In: Werkstoffwissenschaftliche Schriftenreihe 16, 1997Lugscheider, Erich (Editor) -
Lugscheider, Erich (Editor)
Langer, G. (Editor)
Eritt, U. (Editor) -
[Book]
Neue Entwicklungstrends in der Oberflächen- und Fügetechnik
In: Werkstoffwissenschaftliche Schriftenreihe 24, 1997 -
[Contribution to a book]
Optical hot stage microscope for brazing investigations
In: Joining: Ceramics, Glass and Metal, 1997Lugscheider, Erich
Schlimbach, K.
Tillmann, W.
Gale, W. F. -
[Contribution to a book]
Application of finite element method for simulation of heat transfer and residual stresses in plasma sprayed coatings
In: Modern Communication Facilities, Naroch 1997, 131-136, 1997Kundas, S.
Kuzmenkov, A.
Eritt, U.
Lugscheider, Erich -
[Contribution to a book]
Wirkungsgradverbesserung thermoelektronischer MAterialien durch Gradierung - Herstellung durch thermisches Spritzen
In: Neue Entwicklungstrends in der Oberflächen- und Energietechnik, 17-33, 1997Lugscheider, Erich
Langer, G.
Schilz, J.
Müller, E. -
[Contribution to a book]
Prozeßsimulation des PVD MSIP Verfahrens
In: Neue Entwicklungstrends in der Oberflächen- und Fügetechnik, 75-83, 1997Lugscheider, Erich
Barimani, Cyrus
Eckert, P. -
[Book]
Entwicklungsbegleitende Risikobehandlung neuer Technologien am Beispiel der Physical Vapour Deposition (PVD) Technologie (Habil.-Schr. RWTH Aachen 1997)
In: Werkstoffwissenschaftliche Schriftenreihe 17, 1997Löffler, Frank -
[Book]
Wekstoffe für strahlverschleißbeanspruchte Funktionsflächen in der fossilen Energietechnik
In: Werkstoffwissenschaftliche Schriftenreihe 18, 1997Melzer, Andreas -
[Book]
Hochlegierte PM-HIP-Werkstoffe gegen abrasiven und adhäsiven Verschleißschutz
In: Werkstoffwissenschaftliche Schriftenreihe 19, 1997Deppe, Erich -
[Book]
Herstellung und In-vitro-Charakterisierung von Keramiken aus dem ternären System Al2O3-SiO3-TiO2
In: Werkstoffwissenschaftliche Schriftenreihe 20, 1997Haßmann, Nico -
[Contribution to a conference proceedings]
Process modelling and -control of atmospheric plasma spraying of alumina coatings
In: Progress in Plasma Processing of Materials 1997 : Proc. of the 4. Intern. Thermal Plasma Processes Conf., Athens, 15.-18.07.1996 / Fauchais, P. (Hrsg.), 1997Lugscheider, Erich
Ladru, F.
Eritt, U.
Landes, K.
Reusch, A.
et al. -
[Contribution to a conference proceedings]
Numerical prediction of fluid dynamcis of an atmospheric plasma jet
In: Progress in Plasma Processing of Materials 1997 : Proc. of the 4. Intern. Thermal Plasma Processes Conf., Athens, 15.-18.07.1996 / Fauchais, P. (Hrsg.), 1997Lugscheider, Erich
Barimani, Cyrus
Eckert, P.
Eritt, U. -
[Contribution to a conference proceedings]
Modelling and simulation of substrate-film mixing in PVD-magnetron sputter ion plating coating by molecular dynamic calculation
In: Materials, Functionality & Design: Proc. of the 5. Europ. Conf. on Advanced Materials and Processes and Applications: EUROMAT '97, Maastricht, 21.-23.4.1997, 1997Lugscheider, Erich
Barimani, Cyrus
Eckert, P.
von Hayn, Gunter -
[Contribution to a conference proceedings]
Recent advances in sintering and plasma spraying of MoSi2
In: Materials, Functionality & Design: Proc. of the 5. Europ. Conf. on Advanced Materials and Processes and Applications: EUROMAT '97, Maastricht, 21.-23.4.1997, 1997Lugscheider, Erich
Jansen, F.
Deiser, C. -
[Contribution to a conference proceedings]
Thermal spray coatings replacing hard chromium platings
In: Materials, Functionality & Design: Proc. of the 5. Europ. Conf. on Advanced Materials and Processes and Applications: EUROMAT 97, Maastricht, 21.-23.4.1997, 245-251, 1997Lugscheider, Erich
Jungklaus, H.
Reymann, H.
Langer, G.
Turn Page
- First Page
- Previous Page
- 1301-1350
- 1451-1500
- 1501-1550
- Sie sind auf Seite:1551-1600
- 1601-1650
- 1651-1700
- Last Page
- Next Page
- 1801-1850