[Beitrag zu einem Tagungsband, Fachzeitschriftenartikel]
Magnetronsputtered hard material coatings on thermoplastic polymers for clean room applications
In: Thin solid films, ..., 1998

Lugscheider, Erich
Bärwulf, Stephan
Barimani, Cyrus
Riester, M.
Hilgers, H.

[Beitrag zu einem Tagungsband, Fachzeitschriftenartikel]
Investigation of new arc PVD coatings in the system Ti-Hf-C-N
In: Thin solid films, ..., 145-145, 1998

Lugscheider, E.
Knotek, O.
Zimmermann, H.
Stricker, S.

[Beitrag zu einem Tagungsband, Fachzeitschriftenartikel]
Corrosion tests of PVD coatings with die dressing used for Al high-pressure die-casting dies
In: Thin solid films, ..., 1998

Lugscheider, Erich
Barimani, Cyrus
Guerreiro, S.
Bobzin, Kirsten

[Fachzeitschriftenartikel]
Vergleich verschiedener Meßmethoden zur Bestimmung der Partikelgröße von Pulvern zum Plasmaspritzen
In: Schweissen und Schneiden, 50, 724-731, 1998

Lugscheider, E.
Suk, H.-G.
Lee, H.-K.

[Fachzeitschriftenartikel]
Beschichtungstechnologien entwickeln sich mit den Anforderungen: Über den Masseneinsatz entscheidet ein konsequent durchgeführtes Qualitätsmanagement
In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 7 (2), 12-13, 1998

Lugscheider, E.

[Fachzeitschriftenartikel]
Analysis of a-BxCy:Hz coatings with IBA techniques
In: Nuclear instruments & methods in physics research / Section B, Beam interactions with materials and atoms, 136/138, 258-262, 1998

Lugscheider, Erich
Giorginis, G.
Persson, L.
Hult, M.
Siry, C. W.
et al.

[Fachzeitschriftenartikel]
Innenbeschichtung von Aluminium Motorblöcken mittels PVD-Technik - Teil 1
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 89 (2), 40-42, 1998

Lugscheider, Erich
Wolff, C.

[Fachzeitschriftenartikel]
Processing, structure and tribological behaviour of TiC-reinforced plasma sprayed coatings
In: Wear, 220 (1), 34-50, 1998
[DOI: 10.1016/S0043-1648(98)00237-3]

Economou, S.
de Bonte, Marc
Celis, Jean-Pierre
Smith, R. W.
Lugscheider, Erich

[Fachzeitschriftenartikel]
Plasma-arc powder surfacing - comparison of standard and high-productivity processes
In: Schweissen und Schneiden, 50, E28-E31, 1998

Lugscheider, Erich
Langer, G.

[Buchbeitrag, Fachzeitschriftenartikel]
Wie High-Tech Beschichtungen laufen lernen : Oberflächenmodifikation an Bauteilen für die Medizintechnik
In: RWTH-Themen : Berichte aus der Rheinisch-Westfälischen Technischen Hochschule Aachen, 1998, 40-42, 1998

Kyeck, Sascha
Lake, Mark
Lugscheider, Erich

[Fachzeitschriftenartikel]
High-speed flame-sprayed chromium coatings for wear and corrosion protection
In: Schweissen und Schneiden, 50, E36-E39, 1998

Lugscheider, Erich
Reymann, H.

[Fachzeitschriftenartikel]
Ceramic thermal barrier coatings deposited with the electron beam-physical vapour deposition technique
In: Surface & coatings technology, 98 (1/3), 1221-1227, 1998

Lugscheider, Erich
Barimani, Cyrus
Döpper, G.

[Fachzeitschriftenartikel]
Hochgeschwindigkeitsflammgespritzte Chromschichten zum Verschleiß- und Korrosionsschutz
In: Schweissen und Schneiden, 50 (1), 44-47, 1998

Lugscheider, Erich
Reymann, H.

[Fachzeitschriftenartikel]
Possibilities and limits of the characterization of wear resistant PVD coatings by photothermal spectroscopy
In: Surface & coatings technology, 98 (1/3), 971-975, 1998
[DOI: 10.1016/S0257-8972(97)00308-3]

Hayn, G. v.
Knotek, O.
Lugscheider, Erich
Zimmermann, H.
Zimmermann, H.

[Fachzeitschriftenartikel]
(Cr:Al)N coatings deposited by cathodic vacuum ARC evaporation
In: Surface & coatings technology, 98 (1/3), 1233-1239, 1998
[DOI: 10.1016/S0257-8972(97)00238-7]

Lugscheider, Erich
Vetter, J.
Guerreiro, S.

[Fachzeitschriftenartikel]
Heat-resistant active brazing of silicon-nitride. Part 2: Metallurgical characterization of the braze joints
In: Welding journal, 77 (Suppl.), 103-109, 1998

Lugscheider, Erich
Tillmann, W.
Schlimbach, K.
Manter, C.
Indacochea, C. A.

[Fachzeitschriftenartikel]
Comparison of different measuring methods for the determination of the particle size of powders for plasma spraying
In: Schweissen und Schneiden, 50, E219-E222, 1998

Lugscheider, Erich
Suk, H.-G.
Lee, H.-K.

[Fachzeitschriftenartikel]
On the thermoelectric performance of plasma spray-formed iron disilicide
In: Journal of materials science / Letters, 17, 1487-1490, 1998

Lugscheider, Erich
Schilz, J.
Müller, E.
Schakenberg, K.
Ernst, H.
et al.

[Fachzeitschriftenartikel]
Wear and cutting performance of coated microdrills
In: Surface & coatings technology, 107, 191-196, 1998

Löffler, F.

[Fachzeitschriftenartikel]
Corrosion tests of PVD coatings with die dressing used for Al high-pressure die-casting dies
In: Surface & coatings technology, 108/109, 408-412, 1998

Lugscheider, Erich
Barimani, Cyrus
Guerreiro, S.
Bobzin, Kirsten

[Fachzeitschriftenartikel]
Magnetron-sputtered hard material coatings on thermoplastic polymers for clean room applications
In: Surface & coatings technology, 108/109, 398-402, 1998

Lugscheider, Erich
Bärwulf, Stephan
Barimani, Cyrus
Riester, C.
Hilgers, H.

[Buch, Bericht]
High temperature and acid corrosion of stainless steel : final report
In: EUR 18625 : Technical Steel Research - Properties and In-Service Performance, 1998

Grewe, Hans
Lugscheider, Erich

[Beitrag zu einem Tagungsband, Fachzeitschriftenartikel]
Investigations on hard coated reamers in different lubricant free cutting operations
In: Surface & coatings technology, 90 (1/2), 172-177, 1997
[DOI: 10.1016/S0257-8972(96)03114-3]

Lugscheider, Erich
Knotek, O.
Barimani, C.
Leyendecker, T.
Lemmer, O.
et al.

[Buchbeitrag, Beitrag zu einem Tagungsband]
Numerische Untersuchungen an plasma-gespritzten Schichten
In: Innovationen für Gleitlager, Wälzlager, Dichtungen und Führungen : VDI-Werkstofftag '97 ; 13. Jahrestagung Neu-Ulm, 10. und 11. Juni 1997 / VDI-Gesellschaft Werkstofftechnik, 1997

Elsing, Rainer
Machayekhi, B.

[Buchbeitrag, Beitrag zu einem Tagungsband]
Corrosion and wear resistant ternary Cr-C-N coatings deposited by the arc PVD process for machining tools and machining parts
In: Advanced materials-97 : [proceedings of the 5th International Symposium on Advanced Materials, 21 - 25th September, 1997, Islamabad, Pakistan] / organized and publ. by: A. Q. Khan Research Laboratories. Ed.: M. Afzal Khan ..., 478-485, 1997

Knotek, Otto
Lugscheider, Erich
Zimmermann, Harald
Bobzin, Kirsten

[Tagungsband]
Innovative Werkstofftechnologie 1996: 4. Werkstoffwissenschaftliches Koll
In: Werkstoffwissenschaftliche Schriftenreihe 16, 1997

Lugscheider, Erich (Editor)

[Buch]
Werkstoffwissenschaften: Jahrbuch 1996
In: Werkstoffwissenschaftliche Schriftenreihe, 1997

Lugscheider, Erich (Editor)
Langer, G. (Editor)
Eritt, U. (Editor)

[Buch]
Neue Entwicklungstrends in der Oberflächen- und Fügetechnik
In: Werkstoffwissenschaftliche Schriftenreihe 24, 1997

 

[Buchbeitrag]
Optical hot stage microscope for brazing investigations
In: Joining: Ceramics, Glass and Metal, 1997

Lugscheider, Erich
Schlimbach, K.
Tillmann, W.
Gale, W. F.

[Buchbeitrag]
Application of finite element method for simulation of heat transfer and residual stresses in plasma sprayed coatings
In: Modern Communication Facilities, Naroch 1997, 131-136, 1997

Kundas, S.
Kuzmenkov, A.
Eritt, U.
Lugscheider, Erich

[Buchbeitrag]
Wirkungsgradverbesserung thermoelektronischer MAterialien durch Gradierung - Herstellung durch thermisches Spritzen
In: Neue Entwicklungstrends in der Oberflächen- und Energietechnik, 17-33, 1997

Lugscheider, Erich
Langer, G.
Schilz, J.
Müller, E.

[Buchbeitrag]
Prozeßsimulation des PVD MSIP Verfahrens
In: Neue Entwicklungstrends in der Oberflächen- und Fügetechnik, 75-83, 1997

Lugscheider, Erich
Barimani, Cyrus
Eckert, P.

[Buch]
Entwicklungsbegleitende Risikobehandlung neuer Technologien am Beispiel der Physical Vapour Deposition (PVD) Technologie (Habil.-Schr. RWTH Aachen 1997)
In: Werkstoffwissenschaftliche Schriftenreihe 17, 1997

Löffler, Frank

[Buch]
Wekstoffe für strahlverschleißbeanspruchte Funktionsflächen in der fossilen Energietechnik
In: Werkstoffwissenschaftliche Schriftenreihe 18, 1997

Melzer, Andreas

[Buch]
Hochlegierte PM-HIP-Werkstoffe gegen abrasiven und adhäsiven Verschleißschutz
In: Werkstoffwissenschaftliche Schriftenreihe 19, 1997

Deppe, Erich

[Buch]
Herstellung und In-vitro-Charakterisierung von Keramiken aus dem ternären System Al2O3-SiO3-TiO2
In: Werkstoffwissenschaftliche Schriftenreihe 20, 1997

Haßmann, Nico

[Beitrag zu einem Tagungsband]
Process modelling and -control of atmospheric plasma spraying of alumina coatings
In: Progress in Plasma Processing of Materials 1997 : Proc. of the 4. Intern. Thermal Plasma Processes Conf., Athens, 15.-18.07.1996 / Fauchais, P. (Hrsg.), 1997

Lugscheider, Erich
Ladru, F.
Eritt, U.
Landes, K.
Reusch, A.
et al.

[Beitrag zu einem Tagungsband]
Numerical prediction of fluid dynamcis of an atmospheric plasma jet
In: Progress in Plasma Processing of Materials 1997 : Proc. of the 4. Intern. Thermal Plasma Processes Conf., Athens, 15.-18.07.1996 / Fauchais, P. (Hrsg.), 1997

Lugscheider, Erich
Barimani, Cyrus
Eckert, P.
Eritt, U.

[Beitrag zu einem Tagungsband]
Modelling and simulation of substrate-film mixing in PVD-magnetron sputter ion plating coating by molecular dynamic calculation
In: Materials, Functionality & Design: Proc. of the 5. Europ. Conf. on Advanced Materials and Processes and Applications: EUROMAT '97, Maastricht, 21.-23.4.1997, 1997

Lugscheider, Erich
Barimani, Cyrus
Eckert, P.
von Hayn, Gunter

[Beitrag zu einem Tagungsband]
Recent advances in sintering and plasma spraying of MoSi2
In: Materials, Functionality & Design: Proc. of the 5. Europ. Conf. on Advanced Materials and Processes and Applications: EUROMAT '97, Maastricht, 21.-23.4.1997, 1997

Lugscheider, Erich
Jansen, F.
Deiser, C.

[Beitrag zu einem Tagungsband]
Thermal spray coatings replacing hard chromium platings
In: Materials, Functionality & Design: Proc. of the 5. Europ. Conf. on Advanced Materials and Processes and Applications: EUROMAT 97, Maastricht, 21.-23.4.1997, 245-251, 1997

Lugscheider, Erich
Jungklaus, H.
Reymann, H.
Langer, G.

[Beitrag zu einem Tagungsband]
Wear resistance by way of surface brazing processes
In: Materials, Functionality & Design: Proc. of the 5. Europ. Conf. on Advanced Materials and Processes and Applications: EUROMAT 97, Maastricht, 21.-23.4.1997, 315-318, 1997

Lugscheider, Erich
Kortenbruck, G.

[Beitrag zu einem Tagungsband]
Processing of thermoelectric material by thermal spraying
In: Materials, Functionality & Design: Proc. of the 5. Europ. Conf. on Advanced Materials, Processes and Applications: EUROMAT 97, Maastricht, 21.-23.4.1997, 411-415, 1997

Lugscheider, Erich
Jungklaus, H.
Mathesius, R.
Langer, G.
Schilz, J.

[Beitrag zu einem Tagungsband]
Characterization of thermal properties of TiN and TiAIN thin films deposited on HSS, by means of photothermal spectroscopy
In: Materials, Functionality & Design: Proc. of the 5. Europ. Conf. on Advanced Materials, Processes and Design: EUROMAT 97, Maastricht, 21.-23.4.1997, 193-198, 1997

Lugscheider, Erich
Barimani, Cyrus
Zimmermann, H.
Lake, M.

[Beitrag zu einem Tagungsband]
Improved wear resistance by Tailor-suited thermal spray coatings
In: 14. Intern. Plansee Seminar, Reutte, 1997, 342-354, 1997

Lugscheider, Erich
Jungklaus, H.
Reymann, H.

[Beitrag zu einem Tagungsband]
High Al-content Ti-Al-N PVD-cathodic arc coatings
In: 14. Intern. Plansee Seminar, Reutte 1997, 223-236, 1997

Lugscheider, Erich
Knotek, O.
Barimani, Cyrus
Guerreiro, S.

[Beitrag zu einem Tagungsband]
Abscheidung und Charakterisierung vo dünnen Hartstoffschichten auf Kunststoffen
In: DGM-Hauptversammlung 97, Braunschweig 1997, 20-20, 1997

Lugscheider, Erich
Bärwulf, Stephan
Hilgers, H.
Riester, M.

[Beitrag zu einem Tagungsband]
Löten
In: VDEh/IFB-Seminar 21/97: Nichtrostende Stähle, Düsseldorf 1997, 18 S., 1997

Lugscheider, Erich
Sicking, R.

[Beitrag zu einem Tagungsband]
Advanced brazing technology
In: IIW-Congress, San Francisco 1997, 1997

Lugscheider, Erich
Broich, U.
Buschke, I.
Martinez, L.

[Beitrag zu einem Tagungsband]
Anforderungen und Charakterisierungen beschichteter Polymere für Reinraumanwendungen
In: Verbundwerkstoffe und Werkstoffverbunde, Kaiserslautern, 17.-19.9.1997, 141-150, 1997

Hilgers, H.
Bärwulf, Stephan
Emele, E.
Friedrich, K.
Lugscheider, Erich
et al.