Articles in journals

 
Source Author(s)
[Journal Article]
Vorteile durch gepulste Verdampfung
In: Magazin für Oberflächentechnik, 77 (1/2), 36-38, 2023
Bobzin, Kirsten
Kalscheuer, Christian
Möbius, Max Philip (Corresponding author)
Eichenhofer, Gerhard
[Journal Article]
Correlation Between Process Parameters and Particle In-flight Behavior in AC-HVAF
In: Journal of thermal spray technology, 2023
[DOI: 10.1007/s11666-023-01543-z]
Bobzin, Kirsten
Heinemann, Hendrik
Jasutyn, Kevin (Corresponding author)
[Journal Article]
Replication of Particle Trajectories in the Plasma Jet with Two Consecutive Residual Neural Networks
In: Journal of thermal spray technology, 2023
[DOI: 10.1007/s11666-023-01533-1]
Bobzin, Kirsten
Heinemann, Hendrik
Dokhanchi, Seyed Ruhollah (Corresponding author)
Rom, Christian Michael
[Journal Article]
Calcia-magnesia-alumino-silicate-induced degradation of (Gd0.9Yb0.1)2Zr2O7 thermal barrier coatings prepared by plasma spray-physical vapor deposition (PS-PVD)
In: Surface and coatings technology, 454, 129179, 2022
[DOI: 10.1016/j.surfcoat.2022.129179]
Li, Shan
Chen, Wenbo
Zhao, Lidong
Guo, Hongbo (Corresponding author)
[Journal Article]
Development of Near Net Shaped Coatings for Reduced Postprocessing Costs in Valves
In: Journal of thermal spray technology, 12 Seiten, 2023
[DOI: 10.1007/s11666-023-01539-9]
Bobzin, Kirsten
Heinemann, Hendrik
Burbaum, Elisa
Schulz, Marvin (Corresponding author)
[Journal Article]
Modeling the Droplet Impact on the Substrate with Surface Preparation in Thermal Spraying with SPH
In: Journal of thermal spray technology : JTST, 10 Seiten, 2023
[DOI: 10.1007/s11666-023-01534-0]
Bobzin, Kirsten
Heinemann, Hendrik
Jasutyn, Kevin (Corresponding author)
Jeske, Stefan Rhys
Bender, Jan Stephen
Warkentin, Sergej
Mokrov, Oleg
Sharma, Rahul
Reisgen, Uwe
[Journal Article]
3D deformation modeling of CrAlN coated tool steel compound during nanoindentation
In: Surface and coatings technology, 453, 129148, 2023
[DOI: 10.1016/j.surfcoat.2022.129148]
Bobzin, Kirsten
Kalscheuer, Christian
Carlet, Marco
Schmauder, Siegfried
Guski, Vinzenz
Verestek, Wolfgang
Tayyab, Muhammad (Corresponding author)
[Journal Article]
Tribological performance of (Cr,Al)N+Mo:W:Sg in fluid-free friction regime
In: Wear : an international journal on the science and technology of friction, lubrication and wear, 512/513, 204557, 2022
[DOI: 10.1016/j.wear.2022.204557]
Bobzin, Kirsten
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
[Journal Article]
An Approach to Synthesize Thick α- and γ-Al2O3 Coatings by High-Speed Physical Vapor Deposition
In: Advanced engineering materials, 25 (4), 2201195, 2022
[DOI: 10.1002/adem.202201195]
Bobzin, Kirsten
Kalscheuer, Christian
Hassanzadegan Aghdam, Parisa (Corresponding author)
[Journal Article]
DLC-Coated Thermoplastics : Tribological Analyses Under Dry and Lubricated Sliding Conditions
In: Tribology letters, 71 (1), 2, 2022
[DOI: 10.1007/s11249-022-01663-7]
Bobzin, Kirsten
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
Sperka, P.
Hartl, M.
Reitschuster, S.
Maier, E.
Lohner, T.
Stahl, K.
[Journal Article]
Experimental study and thermodynamic modelling of the ternary system Fe-Ni-Si with re-modelling of the constituent binary systems
In: Journal of alloys and compounds : JAL, 935 (2), 168118, 2022
[DOI: 10.1016/j.jallcom.2022.168118]
Witusiewicz, Viktor T. (Corresponding author)
Stryzhyboroda, Oleg
Vinke, Sophie
Bobzin, Kirsten
Hecht, Ulrike
[Journal Article]
Design and investigation of an FeSiBCNb metallic glass with low electrical and thermal conductivity
In: Journal of alloys and compounds : JAL, 993, 167749, 2022
[DOI: 10.1016/j.jallcom.2022.167749]
Bobzin, Kirsten
Wietheger, Wolfgang
Burbaum, Elisa
Johann, Lukas Martin (Corresponding author)
Glushych, Viktor
[Journal Article]
Development of an Expert System for Prediction of Deposition Efficiency in Plasma Spraying
In: Journal of thermal spray technology : JTST, 2022
[DOI: 10.1007/s11666-022-01494-x]
Bobzin, Kirsten
Heinemann, Hendrik
Dokhanchi, Seyed Ruhollah (Corresponding author)
[Journal Article]
DLC‑Coated Thermoplastics: Tribological Analyses under Lubricated Rolling‑Sliding Conditions
In: Tribology letters, 70 (4), 121, 2022
[DOI: 10.1007/s11249-022-01664-6]
Reitschuster, S. (Corresponding author)
Maier, E.
Lohner, T.
Stahl, K.
Bobzin, Kirsten
Kalscheuer, Christian
Thiex, Matthias
Sperka, P.
Hartl, M.
[Journal Article]
Oxidation stability of chromium aluminum oxynitride hard coatings
In: Surface and coatings technology, 449, 128927, 2022
[DOI: 10.1016/j.surfcoat.2022.128927]
Bobzin, Kirsten
Kalscheuer, Christian
Grundmeier, Guido
De los Arcos, Teresa
Kollmann, Sabrina
Carlet, Marco (Corresponding author)
[Journal Article]
Thermisch gespritzte Beschichtungen für Trockengleitlager
In: Thermal spray bulletin, 15 (2), 104-111, 2022
[DOI: 10.53192/TSB202202104]
Bobzin, Kirsten
Heinemann, Hendrik (Corresponding author)
Burbaum, Elisa (Corresponding author)
Schulz, Marvin (Corresponding author)
[Journal Article]
Influence of the atmospheric plasma spraying parameters on the coating structure and the deposition efficiency of silicon powder
In: The international journal of advanced manufacturing technology, 123, 35-47, 2022
[DOI: 10.1007/s00170-022-10008-6]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Heinemann, Hendrik
Burbaum, Elisa
[Journal Article]
Self-lubricating CrAlMoN high performance tool coatings for machining of TiAl6V4
In: Production engineering, 8 Seiten, 2022
[DOI: 10.1007/s11740-022-01161-8]
Bobzin, Kirsten
Kalscheuer, Christian
Carlet, Marco
Stachowski, Nina Isabell Inge (Corresponding author)
Hintze, W.
Möller, C.
Ploog, P.
[Journal Article]
Bewertung thermisch gespritzter Oxidkeramiken für die Isolationsanwendungen in der Elektromobilität
In: Thermal spray bulletin, 15 (2), 90-96, 2022
Bobzin, Kirsten
Heinemann, Hendrik
Burbaum, Elisa
[Journal Article]
Kalorimetrische Analyse von ternären Fe-Ni-Si-Legierungen für neuartige Lötfolien auf Fe-Basis
In: Schweissen und Schneiden, 74 (6), 368-373, 2022
Bobzin, Kirsten
Heinemann, Hendrik
Hebing, Julian
Stryzhyboroda, Oleg
Vinke, Sophie
[Journal Article]
Adaptive (Cr,Al)N+Mo:Sg Coating for Highly‐Stressed Contacts under Dry Rolling‐Sliding Conditions
In: Tribology international, 174, 107761, 2022
[DOI: 10.1016/j.triboint.2022.107761]
Bobzin, Kirsten
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
Stahl, K.
Lohner, T.
Maier, E.
Yilmaz, M.
[Journal Article]
High-Velocity Arc Spraying of Fe-based Metallic Glasses with High Si Content
In: Journal of thermal spray technology : JTST, 31 (7), 2219-2228, 2022
[DOI: 10.1007/s11666-022-01433-w]
Bobzin, Kirsten
Wietheger, Wolfgang
Burbaum, Elisa
Johann, Lukas Martin (Corresponding author)
[Journal Article]
From cathode to substrate : Plasma diagnostics on high power pulsed magnetron sputtering deposition of titanium nitride
In: Thin solid films, 755, 139331, 2022
[DOI: 10.1016/j.tsf.2022.139331]
Bobzin, Kirsten
Kalscheuer, Christian
Carlet, Marco
Schulze, Christoph Franz Robert (Corresponding author)
[Journal Article]
Influence of brazing process and gap size on the fatigue strength of shear and peel specimen
In: Welding in the world, 66 (10), 1941-1955, 2022
[DOI: 10.1007/s40194-022-01304-6]
Jöckel, A. (Corresponding author)
Baumgartner, J.
Tillmann, W.
Bültena, J.
Bobzin, Kirsten
Heinemann, Hendrik
Hebing, Julian
Erck, Marvin
[Journal Article]
Development of a novel green coating process with laser
In: Scientific reports, 12 (1), 6314, 2022
[DOI: 10.1038/s41598-022-10351-4]
Zhong, Chongliang (Corresponding author)
Backes, Gerhard
Johann, Lukas Martin
Kittel, Jochen
Schopphoven, Thomas
Küppers, Wolfgang
[Journal Article]
Entwicklung dichter Si-Beschichtungen mittels Atmosphärischen Plasmaspritzens
In: Thermal spray bulletin, 15 (1), 34-40, 2022
[DOI: 10.53192/TSB20220126]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Wietheger, Wolfgang
Burbaum, Elisa (Corresponding author)
[Journal Article]
Low-Temperature Physical Vapor Deposition TiAlCrSiN Coated High-Speed Steel : Comparison Between Shot-Peened and Polished Substrate Condition
In: Advanced engineering materials, 24 (9), 2200099, 2022
[DOI: 10.1002/adem.202200099]
Bobzin, Kirsten
Kalscheuer, Christian
Carlet, Marco
Hoffmann, Dennis Christopher (Corresponding author)
Bergs, Thomas
Uhlmann, Lars Heinz
[Journal Article]
Hybrid reactive sputtering of transition metal aluminum oxynitrides
In: Thin solid films, 742, 139028, 2021
[DOI: 10.1016/j.tsf.2021.139028]
Bobzin, Kirsten
Kalscheuer, Christian
Carlet, Marco (Corresponding author)
Schulze, Christoph Franz Robert
[Journal Article]
Schneller und günstiger zum Ziel
In: Magazin für Oberflächentechnik : mo, 76 (1/2), 32-35, 2022
Bobzin, Kirsten
Kalscheuer, Christian
Carlet, Marco
Schulze, Christoph Franz Robert
[Journal Article]
Comparison of Ceramic Insulation Coatings via Impedance Spectroscopy
In: Journal of thermal spray technology : JTST, 31 (5), 1556-1567, 2022
[DOI: 10.1007/s11666-022-01395-z]
Bobzin, Kirsten
Wietheger, Wolfgang
Burbaum, Elisa (Corresponding author)
Hosenfeldt, Tim
Bagcivan, Nazlim
Öte, Mehmet
Müller, Björn
Kunde, Carsten
Elsner, Anna-Lena
[Journal Article]
Triboaktive Beschichtungen : Neue Entwicklungen für fluidfrei geschmierte Stirnradverzahnungen
In: Vakuum in Forschung und Praxis, 34 (1), 18-23, 2022
[DOI: 10.1002/vipr.202200771]
Bobzin, Kirsten
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
[Journal Article]
Application and benchmark of SPH for modeling the impact in thermal spraying
In: Computational particle mechanics : CPM, 9, 1137-1152, 2022
[DOI: 10.1007/s40571-022-00459-9]
Jeske, Stefan Rhys (Corresponding author)
Bender, Jan Stephen
Bobzin, Kirsten
Heinemann, Hendrik
Jasutyn, Kevin
Simon, Marek Sebastian
Mokrov, Oleg
Sharma, Rahul
Reisgen, Uwe
[Journal Article]
Capturing the Influence of Jet Fluctuations on Particles in Plasma Spraying
In: Journal of thermal spray technology, 31 (1/2), 59-69, 2022
[DOI: 10.1007/s11666-021-01307-7]
Bobzin, Kirsten
Heinemann, Hendrik (Corresponding author)
O'Brien, Andreas
[Journal Article]
CrN/AlN nanolaminates: Architecture, residual stresses, and cracking behavior
In: Journal of vacuum science & technology / A, 40 (1), 013414, 2021
[DOI: 10.1116/6.0001462]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Maier, H. J.
Heidenblut, T.
Besserer, H.-B.
Kahra, C.
Janowitz, Julia (Corresponding author)
[Journal Article]
Impact Resistance and Properties of (Cr,Al,Si)N Coatings Deposited by Gas Flow Sputtering with Pulsed DC Supply
In: Advanced engineering materials, 24 (4), 2101021, 2021
[DOI: 10.1002/adem.202101021]
Bobzin, Kirsten
Kalscheuer, Christian
Hassanzadegan Aghdam, Parisa (Corresponding author)
[Journal Article]
Durability of nanolayer Ti-Al-O-N hard coatings under simulated polycarbonate melt processing conditions
In: Journal of physics / D, 55 (3), 035204, 2021
[DOI: 10.1088/1361-6463/ac2e31]
Brögelmann, Tobias
Bobzin, Kirsten
Grundmeier, G.
de los Arcos, T.
Kruppe, Nathan Christopher
Schwiderek, S.
Carlet, Marco (Corresponding author)
[Journal Article]
Crack Resistance of Diamond‐Like Carbon Coatings : Investigations with Nanoindentation
In: Vakuum in Forschung und Praxis, 33 (6), 36-42, 2021
[DOI: 10.1002/vipr.202100769]
Bobzin, Kirsten
Brögelmann, Tobias
Carlet, Marco (Corresponding author)
Kruppe, Nathan Christopher
Engels, Martin Gottfried
Arghavani, Mostafa
[Journal Article]
Self-lubricating CrAlVN coatings for turning of Ti6Al4V: oxidation and wear behavior
In: Materials science and engineering technology, 52 (12), 1394-1412, 2021
[DOI: 10.1002/mawe.202100042]
Bobzin, Kirsten
Brögelmann, Tobias
Stachowski, Nina Isabell Inge (Corresponding author)
Hintze, W.
Möller, C.
Ploog, P.
[Journal Article]
Tribologischer und korrosiver Einfluss von Grafit in thermisch gespritzten Cr3C2/NiCr-Beschichtungen
In: Thermal spray bulletin, 14 (2), 112-119, 2021
Bobzin, Kirsten
Wietheger, Wolfgang
Burbaum, Elisa
Schulz, Marvin
[Journal Article]
Structural analyses of a CrN/AlN nanolaminate hard coating after nanoscratch test
In: Thin solid films, 738, 138964, 2021
[DOI: 10.1016/j.tsf.2021.138964]
Bobzin, Kirsten
Brögelmann, Tobias
Mayer, Joachim
Iskandar, Mohamad Riza
Kruppe, Nathan Christopher
Naderi, Mona (Corresponding author)
[Journal Article]
Influence of the Titanium Inoculation on the Melting Behavior and Microstructure of Ni 620/X38CrMoV5-1 Brazing Joints
In: Advanced engineering materials, 23 (12), 2100497, 2021
[DOI: 10.1002/adem.202100497]
Bobzin, Kirsten
Wietheger, Wolfgang
Hebing, Julian (Corresponding author)
[Journal Article]
Understanding the Tribological Behavior of Graded (Cr,Al)N + Mo:S in Fluid-Free Friction Regime
In: Tribology letters, 69 (4), 162, 2021
[DOI: 10.1007/s11249-021-01536-5]
Bobzin, Kirsten
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
[Journal Article]
Thermal stability of CrAlN/AlCrN nanolaminate coating deposited by hybrid dcMS/HPPMS after heat treatment with continuous-wave laser
In: Applied surface science, 569, 151024, 2021
[DOI: 10.1016/j.apsusc.2021.151024]
Bobzin, Kirsten
Brögelmann, Tobias
Mayer, Joachim
Aretz, Anke
Iskandar, Mohamad Riza
Kruppe, Nathan Christopher
Naderi, Mona (Corresponding author)
[Journal Article]
Influence of Aluminum Content on the Impact Fatigue of HPPMS CrAlN Coatings on Tool Steel
In: Physical mesomechanics, 24 (5), 625-632, 2021
[DOI: 10.1134/S1029959921050143]
Bobzin, Kirsten
Kalscheuer, Christian
Carlet, Marco
Tayyab, Muhammad (Corresponding author)
[Journal Article]
Thermisch gespritzte Beschichtungen für den Armaturenbau
In: Materials science and engineering technology, 52 (9), 997-1011, 2021
[DOI: 10.1002/mawe.202100032]
Bobzin, Kirsten
Wietheger, Wolfgang
Heinemann, Hendrik
Schulz, Marvin (Corresponding author)
Oechsner, Matthias
Engler, T.
Scheerer, H.
Joung, Y.
[Journal Article]
Influence of a short reverse positive HPPMS pulse on the deposition of CrAlN
In: Surface and coatings technology, 423, 127625, 2021
[DOI: 10.1016/j.surfcoat.2021.127625]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Eichenhofer, G.
Schulze, Christoph Franz Robert (Corresponding author)
[Journal Article]
Influence of residual stresses in hard tool coatings on the cutting performance
In: Journal of manufacturing processes, 69, 340-350, 2021
[DOI: 10.1016/j.jmapro.2021.08.011]
Bobzin, Kirsten
Brögelmann, Tobias
Maier, Hans Jürgen
Heidenblut, Torsten
Kahra, Christoph
Carlet, Marco (Corresponding author)
[Journal Article]
HPPMS tool coatings: Chip formation and friction
In: Vakuum in Forschung und Praxis, 33 (4), 26-33, 2021
[DOI: 10.1002/vipr.202100765]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Carlet, Marco (Corresponding author)
Hoffmann, Dennis Christopher
Breidenstein, Bernd
Krödel-Worbes, Alexander
Beblein, Sascha
[Journal Article]
Smart PVD hard coatings with temperature sensor function
In: Surface and coatings technology, 423, 127631, 2021
[DOI: 10.1016/j.surfcoat.2021.127631]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Janowitz, Julia (Corresponding author)
[Journal Article]
Particle tailored effective particle-gas interaction coefficients during plasma spraying
In: Thermal spray bulletin, 14 (1), 40-45, 2021
Bobzin, Kirsten
Wietheger, Wolfgang
Heinemann, Hendrik
Alkhasli, Ilkin
[Journal Article]
Prediction of Particle Properties in Plasma Spraying based on Machine Learning
In: Journal of thermal spray technology, 30 (7), 1751-1764, 2021
[DOI: 10.1007/s11666-021-01239-2]
Bobzin, Kirsten
Wietheger, Wolfgang
Heinemann, Hendrik
Dokhanchi, Seyed Ruhollah (Corresponding author)
Rom, Christian Michael
Visconti, Giuseppe
[Journal Article]
Pulse synchronized substrate bias for the High Power Pulsed Magnetron Sputtering deposition of CrAlN
In: Thin solid films, 732, 138792, 2021
[DOI: 10.1016/j.tsf.2021.138792]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Engels, Martin Gottfried
Schulze, Christoph Franz Robert (Corresponding author)
[Journal Article]
Design of a TiAlON multilayer coating : Oxidation stability and deformation behavior
In: Surface and coatings technology, 421, 127417, 2021
[DOI: 10.1016/j.surfcoat.2021.127417]
Bobzin, Kirsten
Kalscheuer, Christian
Grundmeier, G.
de los Arcos, T.
Schwiderek, S.
Carlet, Marco (Corresponding author)
[Journal Article]
Self-lubricating triboactive (Cr,Al)N+Mo:S coatings for fluid-free applications
In: Journal of materials science, 56 (27), 15040-15060, 2021
[DOI: 10.1007/s10853-021-06255-9]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
[Journal Article]
Use of displacement and force sensors to improve process control during induction brazing of carbide-steel joints
In: Welding and cutting, 20 (1), 50-56, 2021
Bobzin, Kirsten
Wietheger, Wolfgang
Hebing, Julian
[Journal Article]
Investigation on the incorporation of oxygen and thermal stability of HPPMS TiAlCrSiON nanolayer coatings
In: Surface and coatings technology, 418, 127231, 2021
[DOI: 10.1016/j.surfcoat.2021.127231]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Carlet, Marco (Corresponding author)
[Journal Article]
Development of Thermal Spray Processes for Depositing Coatings on Thermoplastics
In: Journal of thermal spray technology : JTST, 30 (1/2), 157-167, 2021
[DOI: 10.1007/s11666-020-01147-x]
Bobzin, Kirsten
Wietheger, Wolfgang
Knoch, Martin Andreas (Corresponding author)
[Journal Article]
DLC coated spur gears : Part II : coating properties and potential for industrial use
In: Industrial Lubrication and Tribology, 73 (4), 621-634, 2021
[DOI: 10.1108/ILT-07-2020-0256]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Thiex, Matthias
Schwarz, Andreas
Ebner, Martin
Lohner, Thomas
Stahl, Karsten
[Journal Article]
STEM investigations of the influence of copper on alumina scale detachment during in-situ wetting experiments of Al-7Si-0.3Mg alloy with 95Sn-5Cu filler metal
In: International journal of materials research : IJMR, 112 (5), 415-421, 2021
[DOI: 10.1515/ijmr-2020-8028]
Vayyala, Ashok
Aretz, Anke
Bobzin, Kirsten
Wietheger, Wolfgang
Hebing, Julian (Corresponding author)
Iskandar, Mohamad Riza
Mayer, Joachim
Schmidt, Alexander
[Journal Article]
High-Speed Video Analysis of the Process Stability in Plasma Spraying
In: Journal of thermal spray technology : JTST, 30 (4), 987-1000, 2021
[DOI: 10.1007/s11666-021-01159-1]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Alkhasli, Ilkin
Heinemann, Hendrik (Corresponding author)
[Journal Article]
DLC-coated spur gears : part I: friction reduction
In: Industrial lubrication & tribology, 73 (3), 457-469, 2021
[DOI: 10.1108/ILT-07-2020-0257]
Schwarz, Andreas
Ebner, Martin
Lohner, Thomas
Stahl, Karsten
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Thiex, Matthias
[Journal Article]
Thermally sprayed sensor coatings for spatially resolved temperature detection
In: Journal of materials processing technology, 291, 117043, 2021
[DOI: 10.1016/j.jmatprotec.2021.117043]
Bobzin, Kirsten
Wietheger, Wolfgang
Knoch, Martin Andreas
Heinemann, Hendrik
Schacht, Andreas (Corresponding author)
Gillner, Arnold
Hummel, Marc Daniel
[Journal Article]
Softening Behavior of Cold-Sprayed Aluminum-Based Coatings AA1200 and AA7075 During Annealing
In: Journal of thermal spray technology : JTST, 30 (1/2), 358-370, 2020
[DOI: 10.1007/s11666-020-01121-7]
Bobzin, Kirsten
Wietheger, Wolfgang
Hebing, Julian
Gerdt, Leonid (Corresponding author)
[Journal Article]
Enhancement of the insulation properties of thermal sprayed ceramic bearing coatings
In: Bearing world journal, 5, 35-46, 2020
Bobzin, Kirsten
Wietheger, Wolfgang
Knoch, Martin Andreas
Burbaum, Elisa
Hosenfeldt, Tim
Bagcivan, Nazlim
Öte, Mehmet
Heckl, Astrid
Müller, Björn
Kunde, Carsten
Elsner, Anna-Lena
[Journal Article]
HPPMS TiAlCrSiN - Influence of substrate bias and pulse frequency on cutting performance
In: Surface and coatings technology, 397, 126056, 2020
[DOI: 10.1016/j.surfcoat.2020.126056]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Carlet, Marco (Corresponding author)
[Journal Article]
Steigerung der Leistungsfähigkeit technischer Kunststoffe durch DLC-Beschichtungen
In: Tribologie und Schmierungstechnik, 67, 15-24, 2020
[DOI: 10.30419/TuS-2020-0014]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Thiex, Matthias
[Contribution to a book, Contribution to a conference proceedings, Journal Article]
PVD Coated Tools and Surface-Structured Workpieces in Dry Cold Forming of Steel
In: Defect and diffusion forum, 404, 19-27, 2020
[DOI: 10.4028/www.scientific.net/DDF.404.19]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Bergs, Thomas
Mattfeld, Patrick-Marcel
Trauth, Daniel
Hild, Rafael
Hoffmann, Dennis Christopher (Corresponding author)
[Contribution to a book, Contribution to a conference proceedings, Journal Article]
Temperature Measurement on Tool Surfaces by Wear Resistant PVD Sensor Coatings
In: Defect and diffusion forum, 404, 138-145, 2020
[DOI: 10.4028/www.scientific.net/DDF.404.138]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Janowitz, Julia (Corresponding author)
[Contribution to a book, Contribution to a conference proceedings, Journal Article]
Self-Lubricating PVD Hard Coatings Through Tribological Activation
In: Defect and diffusion forum, 404, 109-116, 2020
[DOI: 10.4028/www.scientific.net/DDF.404.109]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Stachowski, Nina Isabell Inge (Corresponding author)
[Journal Article]
Combination of a laser deposition welded corrosion protection coating and a thermally sprayed wear protection coating
In: Thermal spray bulletin, 13 (2), 114-121, 2020
Bobzin, Kirsten
Wietheger, Wolfgang
Knoch, Martin Andreas
Sommer, Jan
Schleifenbaum, Johannes Henrich
[Journal Article]
Nutzung von Weg- und Kraftsensoren zur Verbesserung der Prozesskontrolle beim Induktionslöten von Hartmetall-Stahl-Fügeverbunden
In: Schweissen und Schneiden, 72 (11), 694-701, 2020
Bobzin, Kirsten
Wietheger, Wolfgang
Hebing, Julian
[Journal Article]
Effects of (Cr,Al)N and (Cr,Al,Mo)N coatings on friction under minimum quantity lubrication
In: Surface and coatings technology, 402, 126154 -, 2020
[DOI: 10.1016/j.surfcoat.2020.126154]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian (Corresponding author)
Stahl, K.
Lohner, T.
Yilmaz, M.
[Journal Article]
Brazed coatings for steam turbine blades : impact of the tape architecture and composition on mechanical properties
In: International journal of materials research : IJMR, 111 (11), 916-922, 2020
[DOI: 10.3139/146.111956]
Bobzin, Kirsten
Wietheger, Wolfgang
Hebing, Julian
Gerdt, Leonid (Corresponding author)
Uddin, M.
[Journal Article]
Determination of local deposition efficiency based on in-flight particle diagnostics in plasma spraying
In: Surface and coatings technology, 399, 126118, 2020
[DOI: 10.1016/j.surfcoat.2020.126118]
Bobzin, Kirsten
Wietheger, Wolfgang
Heinemann, Hendrik
Dokhanchi, Seyed Ruhollah (Corresponding author)
[Journal Article]
Heating behaviour of plasma sprayed TiOx/Cr2O3 coatings for injection moulding
In: Surface and coatings technology, 399, 126199, 2020
[DOI: 10.1016/j.surfcoat.2020.126199]
Bobzin, Kirsten
Wietheger, Wolfgang
Knoch, Martin Andreas
Schacht, Andreas (Corresponding author)
[Journal Article]
Excellence cluster "Internet of Production" (IoP) of the RWTH Aachen - The digital world and production of the future
In: Thermal spray bulletin, 13 (1), 12-14, 2020
Brockmann, Matthias
Wassong, Anja
Bobzin, Kirsten
Wietheger, Wolfgang
Heinemann, Hendrik
[Journal Article]
Thermally sprayed coatings for highly stressed sliding bearings
In: Wear : an international journal on the science and technology of friction, lubrication and wear, 458/459, 203415, 2020
[DOI: 10.1016/j.wear.2020.203415]
Bobzin, Kirsten
Wietheger, Wolfgang (Corresponding author)
Jacobs, Georg
Bosse, Dennis
Schröder, Tim
Rolink, Amadeus Franziskus
[Journal Article]
Formation mechanisms of zinc, molybdenum, sulfur and phosphorus containing reaction layers on a diamond-like carbon (DLC) coating
In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 51 (7), 1009-1030, 2020
[DOI: 10.1002/mawe.201900178]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
[Journal Article]
Dry forming of low alloy steel materials by full forward impact extrusion with self-lubricating tool coatings and structured workpieces
In: Dry metal forming open access journal : DMFOAJ, 6, 69-98, 2020
[DOI: 10.26092/elib/167]
Bobzin, Kirsten
Klocke, Fritz
Bergs, Thomas
Brögelmann, Tobias
Feuerhack, Andreas
Kruppe, Nathan Christopher
Hild, Rafael (Corresponding author)
Hoffmann, Dennis Christopher (Corresponding author)
[Journal Article]
Further development of iron-based, titanium carbide reinforced thermal spray coatings for wear protection under corrosive loads
In: Thermal spray bulletin, 13 (1), 44-51, 2020
Bobzin, Kirsten
Wietheger, Wolfgang
Königstein, Tim Denis Stefan
Zhao, Lidong
malik, katarzyna maria
[Journal Article]
Key influencing factors for the thermal shock resistance of La2Zr2O7-based multilayer TBCs
In: Surface and coatings technology, 396, 125951, 2020
[DOI: 10.1016/j.surfcoat.2020.125951]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Wietheger, Wolfgang
Königstein, Tim Denis Stefan
[Journal Article]
A Visit to the Surface Engineering Institte (IOT) of RWTH Aachen University
In: Thermal spray bulletin, 43 (1), 22-23, 2020
Bobzin, Kirsten
Wietheger, Wolfgang (Corresponding author)
[Journal Article]
Comparison of Residual Stress Measurements Conducted by X-ray Stress Analysis and Incremental Hole Drilling Method
In: Journal of thermal spray technology : JTST, 29 (6), 1218-1228, 2020
[DOI: 10.1007/s11666-020-01056-z]
Bobzin, Kirsten
Wietheger, Wolfgang
Knoch, Martin Andreas
Schacht, Andreas (Corresponding author)
Reisgen, Uwe
Sharma, Rahul
Oster, Lukas Emmanuel
[Journal Article]
Approaches and possibilities for reducing residual stresses in induction brazed cemented carbide/steel joints
In: Welding in the world, 64 (9), 1579-1587, 2020
[DOI: 10.1007/s40194-020-00928-w]
Bobzin, Kirsten
Öte, Mehmet
Hebing, Julian (Corresponding author)
[Journal Article]
Correlation of thermal characteristics and microstructure of multilayer electron beam physical vapor deposition thermal barrier coatings
In: Thin solid films, 707, 138081, 2020
[DOI: 10.1016/j.tsf.2020.138081]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Yildirim, Baycan
Welters, Martin (Corresponding author)
[Journal Article]
Influence of direct electric current on wetting behavior during brazing
In: Frontiers of mechanical engineering, 15 (3), 496-503, 2020
[DOI: 10.1007/s11465-019-0582-6]
Bobzin, Kirsten
Wietheger, Wolfgang
Hebing, Julian
Zhao, Lidong
Schmidt, Alexander (Corresponding author)
Iskandar, Mohamad Riza
Mayer, Joachim
[Journal Article]
Macroscopic Modeling of an Agglomerated and Sintered Particle in Air Plasma Spraying
In: Journal of thermal spray technology, 29, 13-24, 2019
[DOI: 10.1007/s11666-019-00964-z]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Alkhasli, Ilkin (Corresponding author)
[Journal Article]
Estimation of Particle Mass Flow Rate in Free Jet Using In-Flight Particle Diagnostics in Plasma Spraying
In: Journal of thermal spray technology : JTST, 29 (5), pages921-931, 2020
[DOI: 10.1007/s11666-020-01027-4]
Bobzin, Kirsten
Wietheger, Wolfgang
Knoch, Martin Andreas
Dokhanchi, Seyed Ruhollah (Corresponding author)
[Journal Article]
ITSC 2020: Amazing Opportunities Await
In: Advanced materials & processes : AM&P, 178 (3), 36-36, 2020
Bobzin, Kirsten
[Journal Article]
Deposition of a nanocomposite (Ti, Al, Si)N coating with high thickness by high-speed physical vapor deposition
In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 51 (3), 297-312, 2020
[DOI: 10.1002/mawe.201900103]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Yildirim, Baycan
Liang, Tiancheng (Corresponding author)
[Journal Article]
Influence of the Injector Head Geometry on the Particle Injection in Plasma Spraying
In: Journal of thermal spray technology : JTST, 29 (4), 534-545, 2020
[DOI: 10.1007/s11666-020-01009-6]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Heinemann, Hendrik (Corresponding author)
[Journal Article]
Fatigue of brazed joints made of X5CrNi18-10 and Cu110 and derivation of reliable assessment approaches
In: Welding in the world, 64 (4), 707-719, 2020
[DOI: 10.1007/s40194-020-00850-1]
Baumgartner, J. (Corresponding author)
Tillmann, W.
Bobzin, Kirsten
Öte, Mehmet
Wiesner, Stefanie
Sievers, N.
[Journal Article]
Arc PVD (Cr,Al,Mo)N and (Cr,Al,Cu)N coatings for mobility applications
In: Surface and coatings technology, 384, 125046, 2019
[DOI: 10.1016/j.surfcoat.2019.125046]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Self‐Lubricating Physical Vapor Deposition Coatings for Dry Cold Massive Forming
In: Steel research international, 91 (5), 1900475, 2019
[DOI: 10.1002/srin.201900475]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Bergs, Thomas
Trauth, Daniel
Hild, Rafael
Mannens, Robby Norbert
Hoffmann, Dennis Christopher (Corresponding author)
[Journal Article]
Evalution of Two Repair Methods for Duplex-Coatings
In: Thermal spray bulletin, 12 (2), 98-104, 2019
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Prenger, Frank
Jantze, Raphael
Krömmer, Werner
[Journal Article]
Hochleistungsplasmen zur Entwicklung dünner Hartstoffschichten für Werkzeuge
In: Werkstoffe in der Fertigung (2), 18-19, 2019
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Carlet, Marco (Corresponding author)
[Journal Article]
Self-lubricating PVD Coatings in Interaction with Textured Workpiece Surfaces for Bulk Metal Forming
In: Dry metal forming open access journal, 5, 39-45, 2019
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Bergs, Thomas
Hild, Rafael
Feuerhack, Andreas
Hoffmann, Dennis Christopher (Corresponding author)
[Journal Article]
Structure, mechanical characteristics and thermal stability of high speed physical vapor deposition (Al,Cr)2O3 coatings
In: Thin solid films, 690, 137529, 2019
[DOI: 10.1016/j.tsf.2019.137529]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Welters, Martin (Corresponding author)
[Journal Article]
Wear behavior and thermal stability of HPPMS (Al,Ti,Cr,Si)ON, (Al,Ti,Cr,Si)N and (Ti,Al,Cr,Si)N coatings for cutting tools
In: Surface and coatings technology, 385, 125370, 2019
[DOI: 10.1016/j.surfcoat.2020.125370]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Carlet, Marco (Corresponding author)
[Journal Article]
Modellierung des Tribosystems beim trockenen Vollvorwärtsfließ-pressen mithilfe eines erweiterten Reibmodells
In: Dry metal forming open access journal, 5, 1-8, 2019
Bergs, Thomas
Hild, Rafael (Corresponding author)
Feuerhack, Andreas
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Hoffmann, Dennis Christopher
[Journal Article]
Effects of the Ion to Growth Flux Ratio on the Constitution and Mechanical Properties of Cr1-x-Alx-N Thin Films
In: ACS combinatorial science, 21 (12), 782-793, 2019
[DOI: 10.1021/acscombsci.9b00123]
Banko, Lars
Ries, Stefan
Grochla, Dario
Arghavani, Mostafa
Salomon, Steffen
Pfetzing-Micklich, Janine
Kostka, Aleksander
Rogalla, Detlef
Schulze, Julian
Awakowicz, Peter
Ludwig, Alfred (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Nanocomposite (Ti,Al,Cr,Si)N HPPMS coatings for high performance cutting tools
In: Surface and coatings technology, 378, 124857, 2019
[DOI: 10.1016/j.surfcoat.2019.07.073]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Carlet, Marco (Corresponding author)
[Journal Article]
Investigation on the influence of oxygen on the deformation and cracking behavior of (Cr,Al)ON hard coatings using combinatorial static and dynamic loadings
In: Journal of vacuum science & technology / A : JVST, 37 (6), 061509, 2019
[DOI: 10.1116/1.5124615]
Brögelmann, Tobias
Bobzin, Kirsten
Kruppe, Nathan Christopher
Arghavani, Mostafa (Corresponding author)
[Journal Article]
Charakterisierung und Bewertung von Emissionen beim Thermischen Spritzen unter produktionsrelevanten Bedingungen
In: Thermal spray bulletin, 12 (2), 78-87, 2019
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan
Wietheger, Wolfgang (Corresponding author)
Kraus, Thomas
Möller, Manfred
[Journal Article]
(Cr,Al)N and (Cr,Al,Mo)N hard coatings for tribological applications under minimum quantity lubrication
In: Tribology international, 140, 105817, 2019
[DOI: 10.1016/j.triboint.2019.06.010]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian (Corresponding author)
Stahl, K.
Lohner, T.
Yilmaz, M.
[Journal Article]
Post-annealing of (Ti,Al,Si)N coatings deposited by high speed physical vapor deposition (HS-PVD)
In: Surface and coatings technology, 375, 752-762, 2019
[DOI: 10.1016/j.surfcoat.2019.06.100]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Liang, Tiancheng (Corresponding author)
[Contribution to a book, Journal Article]
Understanding the deformation and cracking behavior of Cr-based coatings deposited by hybrid direct current and high power pulse magnetron sputtering : From nitrides to oxynitrides
In: Thin solid films, 688, 137354, 2019
[DOI: 10.1016/j.tsf.2019.06.004]
Brögelmann, Tobias
Bobzin, Kirsten
Kruppe, Nathan Christopher
Arghavani, Mostafa (Corresponding author)
[Journal Article]
Influence of Microstructures on Thermal Shock and Sintering Behavior of YSZ-Based Thermal Barrier Coatings
In: Surface technology, 48 (4), 28-33, 2019
[DOI: 10.16490/j.cnki.issn.1001-3660.2019.04.004]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Öte, Mehmet
Königstein, Tim Denis Stefan
[Journal Article]
Laserstrukturierte nitridische und oxinitridische Beschichtungen abgeschieden mittels Mittelfrequenz‐Magnetron‐Sputtering
In: International journal of material science, 50 (9), 1057-1069, 2019
[DOI: 10.1002/mawe.201800170]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Naderi, Mona (Corresponding author)
[Journal Article]
Incorporation of oxygen at column boundaries in (Cr,Al)ON hard coatings
In: Thin solid films, 685, 275-281, 2019
[DOI: 10.1016/j.tsf.2019.06.047]
Brögelmann, Tobias
Bobzin, Kirsten
Kruppe, Nathan Christopher
Carlet, Marco
[Journal Article]
Thermal Cyclic Oxidation Behavior of y-TiAl with in situ post-annealed Al-Si-Y Coating
In: Journal of vacuum science & technology: JVST, 37 (4), 041401, 2019
[DOI: 10.1116/1.5094835]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Liang, Tiancheng (Corresponding author)
[Journal Article]
(Cr,Al)ON Deposited by Hybrid dcMS/HPPMS: A study on Incorporation of Oxygen
In: Surface and coatings technology, 369, 238-243, 2019
[DOI: 10.1016/j.surfcoat.2019.04.066]
Brögelmann, Tobias
Bobzin, Kirsten
Kruppe, Nathan Christopher (Corresponding author)
Carlet, Marco
[Journal Article]
Potenziale thermisch gespritzter Gleitlager für hochbelastete Lagerstellen
In: Thermal spray bulletin, 12 (1), 31-37, 2019
Bobzin, Kirsten
Öte, Mehmet (Corresponding author)
Königstein, Tim Denis Stefan (Corresponding author)
Wietheger, Wolfgang (Corresponding author)
[Journal Article]
Bestimmung der Chromspezies beim Thermischen Spritzen
In: Thermal spray bulletin, 41 (1), 18-19, 2019
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan
Wietheger, Wolfgang
Kraus, Thomas
Möller, Manfred
[Contribution to a book, Journal Article]
PVD-Schutzschichten für Werkzeuge des Präzisionsblankpressens
In: Vakuum in Forschung und Praxis, 31 (2), 25-31, 2019
[DOI: 10.1002/vipr.201900711]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Stanek, Bonnie
Naderi, Mona (Corresponding author)
[Journal Article]
Influence of Oxides on the Performance of Cylinder Bore Coatings of Engine Blocks
In: Advanced composite materials, 21 (7), 1900006, 2019
[DOI: 10.1002/adem.201900006]
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Analysis of wear phenomena during forward extrusion under dry friction conditions
In: Wear : an international journal on the science and technology of friction, lubrication and wear, 426/427 (B), 1362-1370, 2019
[DOI: 10.1016/j.wear.2019.01.127]
Hild, Rafael (Corresponding author)
Bergs, Thomas
Mattfeld, Patrick-Marcel
Trauth, Daniel
Klocke, Fritz
Hoffmann, Dennis Christopher
Kruppe, Nathan Christopher
Brögelmann, Tobias
Bobzin, Kirsten
[Journal Article]
Formation of Tribochemical Reaction Layers on a Metal Modified Amorphous Carbon Coating a-C:H:Zr (ZrCg)
In: Tribology international, 135, 152-160, 2019
[DOI: 10.1016/j.triboint.2019.02.040]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
[Journal Article]
A highly porous thermal barrier coating based on Gd2O3-Yb2O3 co-doped YSZ
In: Surface and coatings technology, 366, 349-354, 2019
[DOI: 10.1016/j.surfcoat.2019.03.064]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Öte, Mehmet
Königstein, Tim Denis Stefan
[Journal Article]
Effect of Different Atomization Gases on the Properties of Cylinder Bore Coatings
In: Advanced engineering materials, 21 (2), 1800853, 2018
[DOI: 10.1002/adem.201800853]
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan (Corresponding author)
[Journal Article]
Development of a FeCrMnBC-based economical wear and corrosion resistant coating
In: Surface and coatings technology, 362, 12-20, 2019
[DOI: 10.1016/j.surfcoat.2019.01.074]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Öte, Mehmet
Königstein, Tim Denis Stefan
[Journal Article]
Wear behavior of HVOF-sprayed Al0.6TiCrFeCoNi high entropy alloy coatings at different temperatures
In: Surface and coatings technology, 358, 215-222, 2018
[DOI: 10.1016/j.surfcoat.2018.11.052]
Chen, Lijia
Bobzin, Kirsten
Zhou, Zheng (Corresponding author)
Zhao, Lidong
Öte, Mehmet
Königstein, Tim Denis Stefan
Tan, Zhen
He, Dingyong
[Journal Article]
Macroscopic particle modeling in air plasma spraying
In: Surface and coatings technology, 364, 449-456, 2018
[DOI: 10.1016/j.surfcoat.2018.07.056]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Alkhasli, Ilkin (Corresponding author)
[Journal Article]
New Material Concepts for Thermally Sprayed Hydrodynamic Bearings
In: Journal of thermal spray technology : JTST, 28 (1/2), 305-313, 2019
[DOI: 10.1007/s11666-018-0822-z]
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan
Wietheger, Wolfgang (Corresponding author)
Schröder, Tim
Jacobs, Georg
Bosse, Dennis
[Journal Article]
Influence of Powder Size on the Corrosion and Wear Behaviorof HVAF-Sprayed Fe-Based Coatings
In: Journal of thermal spray technology : JTST, 28 (1/2), 63-75, 2018
[DOI: 10.1007/s11666-018-0819-7]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Sommer, Jan (Corresponding author)
[Journal Article]
Influence of HPPMS on Hybrid dcMS/HPPMS (Cr,Al)N Processes
In: Surface and coatings technology, 358, 57-66, 2018
[DOI: 10.1016/j.surfcoat.2018.11.032]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher (Corresponding author)
Engels, Martin Gottfried
[Journal Article]
Designing the Corrosion Products of ZnAl15: A new Approach to Smart Corrosion Protection Coatings?
In: Corrosion science, 155, 217-229, 2017
[DOI: 10.1016/j.corsci.2017.12.015]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas (Corresponding author)
[Journal Article]
In situ Analyse beim Löten von Hartmetallen mittels Messungen des elektrischen Widerstandes
In: Materials testing, 60 (4), 349-354, 2018
[DOI: 10.3139/120.111165]
Tillmann, Wolfgang
Sievers, Norman (Corresponding author)
Schmidt, Alexander
Timmer, Christian
[Journal Article]
Neue Möglichkeiten für Fe-basis Beschichtungen durch HVAF-Spritzen
In: 11. Kolloquium Hochgeschwindigkeits-Flammspritzen/HVOF Spraying, 25. und 26. Oktober 2018, Erding : Tagungsunterlagen : conference proceedings / GTS Europe, Linde - The Linde Group, 19-31, 2018
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan
Zhao, Lidong
Sommer, Jan
Malik, Katarzyna (Corresponding author)
[Contribution to a book, Journal Article]
Dünne PVD-Hartstoffschichten zur Online-Temperaturmessung : Datenerfassung in der Grenzfläche zwischen Werkzeug und Werkstück bzw. Schmelze
In: Vakuum in Forschung und Praxis, 30 (6), 28-33, 2018
[DOI: 10.1002/vipr.201800699]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher (Corresponding author)
Stalpers, Lore
Janowitz, Julia
[Journal Article]
Einfluss der Bindereigenschaften und -zersetzung auf die Lötnahtqualität beim großflächigen Fügen mit Lotpasten
In: Schweissen und Schneiden, 70 (6), 390-394, 2018
Bobzin, Kirsten
Öte, Mehmet
Wiesner, Stefanie
Hebing, Julian (Corresponding author)
[Journal Article]
Effect of Heat Treatment on the Phase Composition, Microstructure and Mechanical Properties of Al0.6CrFeCoNi and Al0.6CrFeCoNiSi0.3 High-Entropy Alloys
In: Metals : open access journal, 8 (11), 974, 2018
[DOI: 10.3390/met8110974]
Chen, Lijia
Bobzin, Kirsten
Zhou, Zheng (Corresponding author)
Zhao, Lidong
Öte, Mehmet
Königstein, Tim Denis Stefan
Tan, Zhen
He, Dingyong
[Journal Article]
Einfluss verunreinigter Oberflächenzustände auf das Benetzungsverhalten des Lots Ni 620 auf dem Grundwerkstoff 1.4301
In: Schweissen und Schneiden, 70 (8), 566-570, 2018
Tillmann, Wolfgang (Corresponding author)
Eilers, Arne (Corresponding author)
Wojarski, Lukas (Corresponding author)
Manka, Matthias (Corresponding author)
Bobzin, Kirsten (Corresponding author)
Öte, Mehmet (Corresponding author)
Wiesner, Stefanie (Corresponding author)
[Journal Article]
Entwicklung von HPPMS‐Al2O3‐Beschichtungen für die Zerspanung von schwer zerspanbaren Werkstoffen
In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 49 (11), 1287-1300, 2018
[DOI: 10.1002/mawe.201800008]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher (Corresponding author)
Bastürk, Serhan
Klocke, Fritz
Gerschwiler, Klaus
Kölker, W.
Bolz, S.
Kohlscheen, J.
[Journal Article]
Enhanced PVD process control by online substrate temperature measurement
In: Surface and coatings technology, 354, 383-389, 2018
[DOI: 10.1016/j.surfcoat.2018.07.096]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher (Corresponding author)
[Journal Article]
Laser-structured high performance PVD coatings
In: Surface and coatings technology, 352, 302-312, 2018
[DOI: 10.1016/j.surfcoat.2018.07.094]
Bobzin, Kirsten
Brögelmann, Tobias
Gillner, Arnold
Kruppe, Nathan Christopher
He, Chao
Naderi, Mona
[Journal Article]
A contribution to the thermal effects of DLC coatings on fluid friction in EHL contacts
In: Lubrication science, 30 (6), 285-299, 2018
[DOI: 10.1002/ls.1421]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
Ebner, M.
Lohner, T.
Stahl, K.
[Journal Article]
Thick HS-PVD (Al,Cr)2O3 coatings for challenging cutting and die casting applications
In: Thin solid films, 663, 131-142, 2018
[DOI: 10.1016/j.tsf.2018.06.061]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Welters, Martin (Corresponding author)
[Journal Article]
Investigations on the substrate bias influence on reactive HPPMS plasmas
In: Thin solid films, 663, 62-72, 2018
[DOI: 10.1016/j.tsf.2018.07.048]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Engels, Martin Gottfried (Corresponding author)
[Journal Article]
Al-Si and Al-Si-Y coatings deposited by HS-PVD for the oxidation protection of γ-TiAl
In: Surface and coatings technology, 350, 587-595, 2018
[DOI: 10.1016/j.surfcoat.2018.06.074]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Liang, Tiancheng (Corresponding author)
[Journal Article]
In situ investigation of production processes in a large chamber scanning electron microscope
In: Ultramicroscopy, 193, 151-158, 2018
[DOI: 10.1016/j.ultramic.2018.07.002]
Aretz, Anke
Ehle, Lisa Christine
Häusler, André
Bobzin, Kirsten
Öte, Mehmet
Wiesner, Stefanie
Schmidt, Alexander
Gillner, Arnold
Poprawe, Reinhart
Mayer, Joachim (Corresponding author)
[Journal Article]
Correlation of HPPMS plasma and coating properties using artificial neural networks
In: Surface and coatings technology, 349, 1130-1136, 2018
[DOI: 10.1016/j.surfcoat.2018.06.065]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa
Engels, Martin Gottfried (Corresponding author)
[Journal Article]
Tribological studies on self-lubricating (Cr,Al)N+Mo:S coatings at elevated temperature
In: Surface and coatings technology, 353, 282-291, 2018
[DOI: 10.1016/j.surfcoat.2018.06.067]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Hoffmann, Dennis Christopher (Corresponding author)
Klocke, Fritz
Mattfeld, Patrick-Marcel
Trauth, Daniel
Hild, Rafael
[Journal Article]
Reibungsreduzierung durch gradierte diamantähnliche Kohlenstoffschichten in EHD-Kontakten des Automobilantriebsstrangs
In: Tribologie und Schmierungstechnik, 65 (1), 66-68, 2018
Brögelmann, Tobias
[Journal Article]
12. Aachener Oberflächentechnik Kolloquium : Bericht über die Veranstaltung am 8. Dezember 2017 in Aachen
In: Galvanotechnik, 109 (3), 538-539, 2018
Bobzin, Kirsten
[Journal Article]
High temperature oxidation behavior of Al0.6CrFeCoNi and Al0.6CrFeCoNiSi0.3 high entropy alloys
In: Journal of alloys and compounds, 764, 845-852, 2018
[DOI: 10.1016/j.jallcom.2018.06.036]
Chen, Lijia
Zhou, Zheng (Corresponding author)
Tan, Zhen
He, Dingyong
Bobzin, Kirsten
Zhao, Lidong
Öte, Mehmet
Königstein, Tim Denis Stefan
[Journal Article]
Physical Vapour Deposition : Hartstoffbeschichtungen für die Verarbeitung von Polymethylmethacrylat
In: Galvanotechnik : Fachzeitschrift für die Praxis der Oberflächenbehandlung: Photovoltaik, Dünnschicht- und Plasmatechnik, Mikrosystemtechnik und Umwelttechnik, 109 (5), 873-884, 2018
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Naderi, Mona
[Journal Article]
Development of HVAF-sprayed novel Fe-based coatings for large area applications
In: Thermal spray bulletin, 11 (1), 38-45, 2018
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Sommer, Jan
[Journal Article]
Prozessgrenzen beim Honen thermischer Spritzschichten : Honen korrosionsbeständiger und reibverlustmindernder Eisenbasisschichten für Bohrungsanwendungen
In: wt Werkstattstechnik online, 1/2, 63-66, 2018
Dröder, Klaus
Hoffmeister, Hans-Werner
Mahlfeld, Georg (Corresponding author)
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan (Corresponding author)
Wank, Andreas (Corresponding author)
Schläfer, Thomas
Wessler, Tobias
[Journal Article]
Space-resolved plasma diagnostics in a hybrid (Cr,Al)N process
In: Journal of vacuum science & technology / A, 36 (3), 031515, 2018
[DOI: 10.1116/1.5020151]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Engels, Martin Gottfried (Corresponding author)
[Journal Article]
Einfluss von Oberflächenstrukturierungen auf die Stempelkraft beim Vollvorwärtsfließpressen von 16MnCr5
In: Dry metal forming open access journal, 4, 25-30, 2017
Klocke, Fritz
Hild, Rafael (Corresponding author)
Trauth, Daniel
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Hoffmann, Dennis Christopher
[Journal Article]
Developmement of Novel Fe-Based Coating Systems for Internal Combustion Engines
In: Journal of thermal spray technology : JTST, 27 (4), 736-745, 2018
[DOI: 10.1007/s11666-018-0705-3]
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan (Corresponding author)
Dröder, Klaus
Hoffmeister, Hans-Werner
Mahlfeld, Georg
Schäfer, Thomas
[Journal Article]
Effect of Alloying Elements on Growth Behavior of Intermetallic Compounds at the Cold-Sprayed Coating/Steel Interface During Immersion in Aluminum Melt
In: International journal of metalcasting : IJMC, 12 (4), 712-721, 2018
[DOI: 10.1007/s40962-017-0205-0]
Bobzin, Kirsten
Öte, Mehmet
Wiesner, Stefanie
Gerdt, Leonid (Corresponding author)
Bührig-Polaczek, Andreas
Brachmann, Johannes
[Journal Article]
A novel approach for the prediction of deformation and fracture in hard coatings : Comparison of numerical modeling and nanoindentation tests
In: Mechanics of materials, 117, 192-201, 2017
[DOI: 10.1016/j.mechmat.2017.11.006]
Rezaei, Shahed (Corresponding author)
Arghavani, Mostafa
Wulfinghoff, Stephan
Kruppe, Nathan Christopher
Brögelmann, Tobias
Reese, Stefanie
Bobzin, Kirsten
[Journal Article]
Transfer of Wire Arc-Sprayed Metal Coatings onto Plastic Parts
In: Journal of thermal spray technology, 27 (1-2), 119-134, 2017
[DOI: 10.1007/s11666-017-0667-x]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Liao, Xifang (Corresponding author)
Hopmann, Christian
Ochotta, Philipp
[Journal Article]
Replication of micro-structured injection molds using physical vapor deposition coating and dynamic laser mold tempering
In: Journal of polymer engineering, 38 (3), 315-322, 2017
[DOI: 10.1515/polyeng-2017-0131]
Hopmann, Christian
Bobzin, Kirsten
Brögelmann, Tobias
Orth, Magnus Johannes (Corresponding author)
Kruppe, Nathan Christopher
Naderi, Mona
[Journal Article]
Impact wear of an HVOF-sprayed Cr3C2-NiCr coating
In: International journal of refractory metals & hard materials, 70, 191-196, 2017
[DOI: 10.1016/j.ijrmhm.2017.10.011]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Öte, Mehmet
Königstein, Tim Denis Stefan
Steeger, Martin
[Journal Article]
Tribologischer Einsatz eisenbasierter Wärmedämmschichten in Verbrennungsmotoren
In: Tribologie und Schmierungstechnik, 64 (3), 5-10, 2017
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan
Yao, Haihau
[Journal Article]
Mechanical and tribological characterization of self-lubricating (Cr1-xAlx)N coatings for deposition on complex-shaped forging tools
In: Dry metal forming open access journal, 3, 81-89, 2017
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa
Hoffmann, Dennis Christopher
Klocke, Fritz
Mattfeld, Patrick-Marcel
Trauth, Daniel
Hild, Rafael (Corresponding author)
[Journal Article]
Korrelation der Haftzugfestigkeit thermisch gespritzter Beschichtungen mit der Substrattopografie
In: Thermal spray bulletin, 10 (2), 118-125, 2017
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Sommer, Jan (Corresponding author)
[Contribution to a book, Journal Article]
Beschichtungen für stoff- und formschlüssige Al-Schmelze/Stahlblech-Hybridbauteile
In: Jahrbuch Oberflächentechnik, 73, 139-145, 2017
Bobzin, Kirsten
Bührig-Polaczek, Andreas
Öte, Mehmet
Wiesner, Stefanie
Gerdt, Leonid (Corresponding author)
Brachmann, Johannes
[Contribution to a book, Journal Article]
Physical Vapour Deposition : Hartstoffbeschichtungen für die Verarbeitung von Polymethylmethacrylat
In: Jahrbuch Oberflächentechnik, 73, 116-127, 2017
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Naderi, Mona
[Contribution to a conference proceedings, Journal Article]
High temperature oxidation protection of γ-titanium aluminide using (Cr,Al)ON coatings deposited by high-speed physical vapor deposition
In: Surface and coatings technology, 332, 2-11, 2017
[DOI: 10.1016/j.surfcoat.2017.09.071]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Liang, Tiancheng (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Correlation of the Debye sheath thickness and (Cr,Al)N coating properties for HPPMS, dcMS, CAE and PCAE processes
In: Surface and coatings technology, 332, 233-241, 2017
[DOI: 10.1016/j.surfcoat.2017.06.091]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Engels, Marita (Corresponding author)
[Journal Article]
Advanced deposition of hard a-C:Me coatings by HPPMS using Ne as process gas
In: Surface and coatings technology, 332, 242-252, 2017
[DOI: 10.1016/j.surfcoat.2017.07.089]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Engels, Martin Gottfried (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Plastic deformation behavior of nanostructured CrN/AlN multilayer coatings deposited by hybrid dcMS/HPPMS
In: Surface and coatings technology, 332, 253-261, 2017
[DOI: 10.1016/j.surfcoat.2017.06.092]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa (Corresponding author)
Mayer, Joachim
Weirich, Thomas E.
[Journal Article]
11. Aachener Oberflächentechnik Kolloquium
In: Galvanotechnik, 108, 1224-1225, 2017
Bobzin, Kirsten
[Journal Article]
Triboactive CrAlN+X hybrid dcMS/HPPMS PVD nitride hard coatings for friction and wear reduction on components
In: Surface and coatings technology, 332, 452-463, 2017
[DOI: 10.1016/j.surfcoat.2017.06.089]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian (Corresponding author)
[Journal Article]
Microstructural analysis of germanium modified tin-copper brazing filler metals for transient liquid phase bonding of aluminium
In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 48 (12), 1257-1263, 2017
[DOI: 10.1002/mawe.201700155]
Iskandar, Mohamad Riza (Corresponding author)
Schwedt, Alexander
Mayer, Joachim
Rochala, Patrick
Wiesner, Stefanie
Öte, Mehmet
Bobzin, Kirsten
Weirich, Thomas E.
[Journal Article]
Formation of the reaction zone between tin-copper brazing fillers and aluminum-silicon-magnesium alloys : Experiments and thermodynamic analysis
In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 48 (12), 1241-1248, 2017
[DOI: 10.1002/mawe.201700152]
Bobzin, Kirsten
Öte, Mehmet
Wiesner, Stefanie
Schmidt, Alexander (Corresponding author)
Apel, M.
Berger, R.
Aretz, Anke
Mayer, Joachim
[Journal Article]
Residual stress measurement in AlSi alloys
In: Materialwissenschaft und Werkstofftechnik = Materialwissenschaft und Werkstofftechnik, 48 (12), 1270-1275, 2017
[DOI: 10.1002/mawe.201700157]
Reisgen, Uwe
Sharma, Rahul (Corresponding author)
Gach, Stefan
Olschok, Simon
Francis, J.
Bobzin, Kirsten
Öte, Mehmet
Wiesner, Stefanie
Knoch, Martin Andreas
Schmidt, Alexander
[Journal Article]
Correlative plasma-surface model for metastable Cr-Al-N: Frenkel pair formation and influence of the stress state on the elastic properties
In: Journal of applied physics, 121 (21), 215108, 2017
[DOI: 10.1063/1.4985172]
Music, Denis (Corresponding author)
Banko, Lars
Rueß, Holger
Engels, Martin Gottfried
Hecimovic, Ante
Grochla, Dario
Rogalla, Detlef
Brögelmann, Tobias
Ludwig, Alfred
von Keudell, Achim
Bobzin, Kirsten
Schneider, Jochen M.
[Journal Article]
Thermal Conductivity and Wear Behavior of HVOF-Sprayed Fe-Based Amorphous Coatings
In: Coatings : open access journal, 7 (10), 173, 2017
[DOI: 10.3390/coatings7100173]
Yao, Haihua
Zhou, Zheng (Corresponding author)
Wang, Liang
Tan, Zhen
He, Dingyong
Zhao, Lidong
[Journal Article]
Enhanced replication ratio of injection molded plastic parts by using an innovative combination of laser-structuring and PVD coating
In: Surface and coatings technology, 332, 474-483, 2017
[DOI: 10.1016/j.surfcoat.2017.09.068]
Bobzin, Kirsten
Hopmann, Christian
Gillner, Arnold
Brögelmann, Tobias
Kruppe, Nathan Christopher
Orth, Magnus Johannes
Steger, Michael
Naderi, Mona (Corresponding author)
[Journal Article]
Entwicklung einer neuartigen wirtschaftlichen, eisenbasierten Beschichtung zur Erhöhung der Lebensdauer von Gussbauteilen unter dem Gesichtspunkt der Korrosionsbeständigkeit
In: Materialwissenschaft und Werkstofftechnik, 48 (9), 922-935, 2017
[DOI: 10.1002/mawe.201700165]
Bobzin, Kirsten
Zhao, Lidong
Öte, Mehmet
Königstein, Tim Denis Stefan
Oechsner, M.
Siebers, M. (Corresponding author)
Andersohn, G.
Ellermeier, J.
[Contribution to a conference proceedings, Journal Article]
A Contribution to explain the Mechanisms of Adhesive Wear in Plastics Processing by example of Polycarbonate
In: Surface and coatings technology, 332, 464-473, 2017
[DOI: 10.1016/j.surfcoat.2017.07.080]
Bobzin, Kirsten
Brögelmann, Tobias
Grundmeier, Guido
de los Arcos, Teresa
Wiesing, M.
Kruppe, Nathan Christopher (Corresponding author)
[Contribution to a book, Contribution to a conference proceedings, Journal Article]
Simulation of the Particel Melting Degree in air Plasma Spraying
In: Journal of physics / Conference Series, 825, 012002, 2017
[DOI: 10.1088/1742-6596/825/1/012002]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Alkhasli, Ilkin (Corresponding author)
Reisgen, Uwe
Mokrov, Oleg
Lisnyi, Oleksii
[Journal Article]
Kunststoffe metallisieren
In: KunststoffXtra : Fachberichte, Messen, News, 7 (1/2), 11-15, 2017
Hopmann, Christian
Ochotta, Philipp (Corresponding author)
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Liao, Xifang
[Journal Article]
Fundamental study of an industrial reactive HPPMS (Cr,Al)N process
In: Journal of applied physics, 122 (1), 015302, 2017
[DOI: 10.1063/1.4990997]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Engels, Martin Gottfried (Corresponding author)
von Keudell, A.
Hecimovic, A.
Ludwig, A.
Grochla, Dario
Banko, Lars
[Journal Article]
Mechanical and tribiological characterization of self-lubricating (Cr1-xAlx)N coatings for deposition on complex-shaped forging tools
In: Dry metal forming open access journal, 3, 81-89, 2017
[DOI: 10.18154/RWTH-2017-06971]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa (Corresponding author)
Hoffmann, Dennis Christopher
Klocke, Fritz
Mattfeld, Patrick-Marcel
Trauth, Daniel
Hild, Rafael
[Journal Article]
Investigations on Mechanical and Tribological Behavior of dcMS/HPPMS CrN and (Cr,Al)N Hard Coatings Using Nanoscratch Technique
In: Advanced engineering materials, 19 (6), 1600632, 2017
[DOI: 10.1002/adem.201600632]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa (Corresponding author)
[Journal Article]
Nitridische und oxinitridische HPPMS-Beschichtungen für den Einsatz in der Kunststoffverarbeitung (Teil 2) : Einfluss einer Sauerstoffvariation in (Cr,Al)ON-Beschichtungen auf die chemische Zusammensetzung der nativen Reaktionsschicht, sowie das Benetzungsverhalten gegenüber geschmolzenem und die Haftzugfestigkeit von erstarrtem Polycarbonat
In: Vakuum in Forschung und Praxis, 29 (1), 24-28, 2017
[DOI: 10.1002/vipr.201700634]
Bobzin, Kirsten
Grundmeier, Guido
Brögelmann, Tobias
de los Arcos, Teresa
Wiesing, Martin
Kruppe, Nathan Christopher (Corresponding author)
[Journal Article]
High-rate deposition of thick (Cr,Al)ON coatings by high speed physical vapor deposition
In: Surface and coatings technology, 322, 152-162, 2017
[DOI: 10.1016/j.surfcoat.2017.05.034]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Liang, Tiancheng (Corresponding author)
[Journal Article]
Thermal cycling and isothermal oxidation behavior of quadruple EB-PVD thermal barrier coatings
In: Materialwissenschaft und Werkstofftechnik, 48 (6), 502-518, 2017
[DOI: 10.1002/mawe.201600723]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Yildirim, Baycan
Welters, Martin (Corresponding author)
[Journal Article]
How dry is dry? A critical analysis of surface conditions used in dry metal forming
In: Dry metal forming open access journal, 3, 90-94, 2017
Almohallami, Amer
Arghavani, Mostafa
Böhmermann, F.
Freiße, H.
Herrmann, M.
Mousavi, S. A.
Schöler, S.
Scholz, P.
Tenner, J.
Umlauf, Georg
Teller, Marco
Wulff, D.
Yilkiran, D.
Maier, Hans Jürgen (Corresponding author)
[Journal Article]
Untersuchung der Einflussfaktoren auf die Übertragung von lichtbogendrahtgespritzten Zn-Beschichtungen für die Metallisierung von Kunststoffbauteilen
In: Thermal spray bulletin, 10 (1), 43-49, 2017
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Liao, Xifang
Hopmann, Christian
Ochotta, Philipp
[Journal Article]
Trockenumformung von 42CrS4 mittels Vollvorwärtsfließpressen durch strukturierte Halbzeugoberflächen und selbstschmierende Werkzeugbeschichtungen
In: Dry metal forming open access journal, 4, 7-12, 2017
[DOI: 10.18154/RWTH-2017-04884]
Klocke, Fritz
Hild, Rafael (Corresponding author)
Trauth, Daniel
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa
[Journal Article]
Numerical Study on Plasma Jet and Particle Behavior in Multi-arc Plasma Spraying
In: Journal of thermal spray technology : JTST, 26 (5), 811-830, 2017
[DOI: 10.1007/s11666-017-0564-3]
Bobzin, Kirsten
Öte, Mehmet (Corresponding author)
Schein, J.
Zimmermann, S.
[Contribution to a conference proceedings, Journal Article]
Numerical Coupling of the Particulate Phase to the Plasma Phase in Modeling of Multi-Arc Plasma Spraying
In: Journal of physics / Conference Series, 825, 012003, 2017
[DOI: 10.1088/1742-6596/825/1/012003]
Bobzin, Kirsten
Öte, Mehmet (Corresponding author)
[Journal Article]
High-performance coatings for cutting tools
In: CIRP journal of manufacturing science and technology : CIRP-JMST, 18, 1-9, 2016
[DOI: 10.1016/j.cirpj.2016.11.004]
Bobzin, Kirsten (Corresponding author)
[Journal Article]
Investigation of Amorphous/Nanocrystalline Iron-Based Thermal Barrier Coatings
In: Journal of thermal spray technology : JTST, 26 (3), 388-397, 2017
[DOI: 10.1007/s11666-016-0520-7]
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan (Corresponding author)
[Journal Article]
Influence of Feedstock Materials and Spray Parameters on Thermal Conductivity of Wire-Arc-Sprayed Coatings
In: Journal of materials engineering and performance, 26 (3), 1108-1113, 2017
[DOI: 10.1007/s11665-017-2567-0]
Yao, H. H.
Zhou, Zhe (Corresponding author)
Wang, G. H.
He, D. Y.
Bobzin, Kirsten
Zhao, Lidong
Öte, Mehmet
Königstein, Tim Denis Stefan
[Journal Article]
Microstructure and Properties of FeCrB Alloy Coatings Prepared by Wire-Arc Spraying
In: Journal of thermal spray technology : JTST, 26 (3), 483-491, 2017
[DOI: 10.1007/s11666-016-0510-9]
Yao, H. H.
Zhou, Zhe (Corresponding author)
Wang, Yu-Ming
He, D. Y.
Bobzin, Kirsten
Zhao, Lidong
Öte, Mehmet
Königstein, Tim Denis Stefan
[Journal Article]
Surface Pre-treatment for Thermally Sprayed ZnAl15 Coatings
In: Journal of thermal spray technology : JTST, 26 (3), 464-472, 2017
[DOI: 10.1007/s11666-016-0507-4]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas (Corresponding author)
[Journal Article]
Modeling Plasma-Particle Interaction in Multi-Arc Plasma Spraying
In: Journal of thermal spray technology : JTST, 26 (3), 279-291, 2017
[DOI: 10.1007/s11666-016-0514-5]
Bobzin, Kirsten
Öte, Mehmet (Corresponding author)
[Journal Article]
Characterization of DC magnetron plasma in Ar/Kr/N 2 mixture during deposition of (Cr,Al)N coating
In: Journal of physics / D, Applied physics, 50 (7), 075203, 2017
[DOI: 10.1088/1361-6463/aa4ea2]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, S.
Brugnara, Ricardo H.
Bibinov, N. (Corresponding author)
Awakowicz, P.
[Journal Article]
Influence of long time post annealing on thermal stability and thermophysical properties of plasma sprayed La2Zr2O7 coatings
In: Journal of alloys and compounds : JAL, 695, 2549-2555, 2016
[DOI: 10.1016/j.jallcom.2016.10.328]
Erdogan, Garip (Corresponding author)
Ustel, Fatih
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Zhao, Lidong
[Journal Article]
Evaluation of the shear stresses on surface structured workpieces in dry forming using a novel pin-on-cylinder tribometer with axial feed
In: International journal of material forming, 10 (4), 557-565, 2016
[DOI: 10.1007/s12289-016-1301-z]
Trauth, Daniel (Corresponding author)
Bastürk, Serhan
Hild, Rafael
Mattfeld, Patrick-Marcel
Brögelmann, Tobias
Bobzin, Kirsten
Klocke, Fritz
[Contribution to a conference proceedings, Journal Article]
Novel Fe-based wear and corrosion resistant coatings by three-cathode plasma technology
In: Surface and coatings technology, 318, 288-292, 2016
[DOI: 10.1016/j.surfcoat.2016.08.041]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Öte, Mehmet
Königstein, Tim Denis Stefan
[Journal Article]
Nitridische und oxinitridische HPPMS-Beschichtungen für den Einsatz in der Kunststoffverarbeitung (Teil 1) : Einfluss einer Sauerstoffvariation auf Schichteigenschaften von (Cr,Al)ON und Verbundeigenschaften zwischen Beschichtung und Kunststoffformenstahl
In: Vakuum in Forschung und Praxis, 28 (6), 28-33, 2016
[DOI: 10.1002/vipr.201600632]
Bobzin, Kirsten
Grundmeier, Guido
Brögelmann, Tobias
de los Arcos, Teresa
Wiesing, Martin
Kruppe, Nathan Christopher (Corresponding author)
[Journal Article]
Reactive Air Brazing
In: Info-Service (34), 2-6, 2016
Kopp, Nils
Bobzin, Kirsten
Wiesner, Stefanie
[Journal Article]
TiC-verstärkte, stahlbasierte Werkstoffverbunde und innovative Implementierung im thermischen Spritzen
In: Dialog, 5, 92-102, 2016
Bobzin, Kirsten
Zhao, Lidong
Öte, Mehmet
Link, Thomas
[Contribution to a conference proceedings, Journal Article]
On the plastic deformation of chromium-based nitride hard coatings deposited by hybrid dcMS/HPPMS: A fundamental study using nanoscratch test
In: Surface and coatings technology, 308, 298-306, 2016
[DOI: 10.1016/j.surfcoat.2016.05.093]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa (Corresponding author)
Mayer, Joachim
Weirich, Thomas E.
[Contribution to a conference proceedings, Journal Article]
Synthesis of a-C coatings by HPPMS using Ar, Ne and He as process gases
In: Surface and coatings technology, 308, 80-89, 2016
[DOI: 10.1016/j.surfcoat.2016.07.099]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Engels, Marita (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Influence of dcMS and HPPMS in a dcMS/HPPMS hybrid process on plasma and coating properties
In: Thin solid films, 620, 188-196, 2016
[DOI: 10.1016/j.tsf.2016.07.079]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Engels, Martin Gottfried (Corresponding author)
[Journal Article]
Thermisch gespritzte Gleitlagerwerkstoffe für die Rotorlagerung von Windenergieanlagen
In: Ingenieur-Spiegel : Fachmagazin für Ingenieure / Hellblaue Ausgabe, 2016 (4), 28-29, 2016
Schröder, Tim (Corresponding author)
Jacobs, Georg
Bosse, Dennis
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan
Wietheger, Wolfgang
[Journal Article]
Hybrid dcMS/HPPMS PVD nitride and oxynitride hard coatings for adhesion and abrasion reduction in plastics processing
In: Surface and coatings technology, 308, 349-359, 2016
[DOI: 10.1016/j.surfcoat.2016.07.103]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian (Corresponding author)
Naderi, Mona
[Contribution to a conference proceedings, Journal Article]
Efficiency improvement in automobile bucket tappet/camshaft contacts by DLC coatings : Influence of engine oil, temperature and camshaft speed
In: Surface and coatings technology, 308, 360-373, 2016
[DOI: 10.1016/j.surfcoat.2016.09.041]
Dobrenizki, L.
Tremmel, S.
Wartzack, Sandro
Hoffmann, Dennis Christopher
Brögelmann, Tobias (Corresponding author)
Bobzin, Kirsten
Bagcivan, Nazlim
Musayev, Y.
Hosenfeldt, T.
[Contribution to a conference proceedings, Journal Article]
Analysis of CrN/AlN/Al2O3 and two industrially used coatings deposited on die casting cores after application in an aluminum die casting machine
In: Surface and coatings technology, 308, 374-382, 2016
[DOI: 10.1016/j.surfcoat.2016.09.040]
Bobzin, Kirsten
Brögelmann, Tobias
Hartmann, U.
Kruppe, Nathan Christopher (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
(Cr,Al)N/(Cr,Al)ON Oxy-nitride Coatings deposited by Hybrid dcMS/HPPMS for Plastics Processing Applications
In: Surface and coatings technology, 308, 394-403, 2016
[DOI: 10.1016/j.surfcoat.2016.07.093]
Bobzin, Kirsten
Brögelmann, Tobias
Grundmeier, G.
de los Arcos, Teresa
Wiesing, M.
Kruppe, Nathan Christopher (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Synthesis, characterization, and tribological evaluation of HPPMS (Cr1 − xAlx)N + MoSy coatings
In: Surface and coatings technology, 308, 383-393, 2016
[DOI: 10.1016/j.surfcoat.2016.07.089]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Bastürk, Serhan
Klocke, Fritz
Mattfeld, Patrick-Marcel
Trauth, Daniel
Hild, Rafael (Corresponding author)
[Journal Article]
Influence of Boron Content on Microstructure and Properties of Wire-arc Sprayed Fe-based Coatings
In: Thermal spray bulletin, 9 (1), 60-68, 2016
Yao, Haihua
Zhou, Zheng
Wang, Yiming
He, Ding-Young
Bobzin, Kirsten
Zhao, Lidong
Öte, Mehmet
Linke, Thomas Frederik
Königstein, Tim Denis Stefan
[Journal Article]
Thermisch gespritzte Korrosionsschutzschichten, eine Ergänzung zur Feuerverzinkung!
In: WOMag : Kompetenz in Werkstoff und funktioneller Oberfläche, 5 (6), 41, 2016
[DOI: 10.7395/2016/Knoch01]
Bobzin, Kirsten
Öte, Mehmet
Schulz, Christiane
Knoch, Martin Andreas
[Journal Article]
Tribologisches Verhalten von eisenbasierten Titankarbid verstärkten thermisch gespritzten Schichten
In: Tribologie und Schmierungstechnik, 5, 19-24, 2016
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Malik, Katarzyna
Königstein, Tim Denis Stefan
[Journal Article]
Process Development for Innovative Iron Alloy Metallic Glass Coatings
In: Advanced engineering materials, 18 (10), 1833-1840, 2016
[DOI: 10.1002/adem.201600177]
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Königstein, Tim Denis Stefan (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Effect of long-term heat-treatment at 1150°C on the microstructure and properties of thermal barrier coatings based on ZrO2-4mol.% Y2O3-1mol.% Gd2O3-1mol.% Yb2O3
In: Surface and coatings technology, 318, 142-146, 2016
[DOI: 10.1016/j.surfcoat.2016.06.055]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Öte, Mehmet
Königstein, Tim Denis Stefan
[Journal Article]
Investigation of Reactive HPPMS Process and Influence of Bias Voltage during Deposition of Alumina Coatings
In: Advanced engineering materials, 18 (4), 665-670, 2016
[DOI: 10.1002/adem.201500417]
Bobzin, Kirsten
Brögelmann, Tobias
Brugnara, Ricardo H.
Bastürk, Serhan (Corresponding author)
Bagcivan, Nazlim
[Journal Article]
Influence of HPPMS pulse parameters on the reactive gas N2 and on the properties of (Cr, Al)N coatings
In: Surface and coatings technology, 293, 28-34, 2015
[DOI: 10.1016/j.surfcoat.2015.12.072]
Bobzin, Kirsten
Brögelmann, Tobias
Brugnara, Ricardo H.
Kruppe, Nathan Christopher (Corresponding author)
Chromy, Stephan
[Journal Article]
Modelling the Plasma Jet in Multi-Arc Plasma Spraying
In: Journal of thermal spray technology : JTST, 25 (6), 1111-1126, 2016
[DOI: 10.1007/s11666-016-0438-0]
Bobzin, Kirsten
Öte, Mehmet (Corresponding author)
Schein, J.
Zimmermann, Stephan
Möhwald, K.
Lummer, C.
[Journal Article]
Drei Mikrometer Hightech - Einsatz von PVD-Beschichtungen zur Verbesserung des Extrusionsprozesses
In: Kunststoffe, 106 (7), 62-65, 2016
Hopmann, Christian
Höfs, Christopher Frederic (Corresponding author)
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Naderi, Mona
[Contribution to a conference proceedings, Journal Article]
Minimizing Frictional Losses in Crankshaft Bearings of Automobile Powertrain by Diamond-like Carbon Coatings under Elasto-hydrodynamic Lubrication
In: Surface and coatings technology, 290, 100-109, 2016
[DOI: 10.1016/j.surfcoat.2015.08.064]
Bobzin, Kirsten
Brögelmann, Tobias (Corresponding author)
[Journal Article]
Verformungsverhalten nanostrukturierter HPPMS-Hartstoffschichten
In: Vakuum in Forschung und Praxis, 28 (3), 18-25, 2016
[DOI: 10.1002/vipr.201600604]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa (Corresponding author)
[Journal Article]
Thermische Auslagerung eines mehrlagigen Oxidationsschutz-Beschichtungssystems für γ-Titaniumaluminide
In: Thermal spray bulletin, 9 (1), 34-40, 2016
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
[Journal Article]
HPPMS (Cr1-xAlx)N+WSy Coatings for the Application in Dry Cold Forging of Steel: Synthesis and Raman Characterization
In: Dry metal forming open access journal, 2, 72-77, 2016
[DOI: 10.18154/RWTH-2016-04878]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa
Bastürk, Serhan (Corresponding author)
Klocke, Fritz
Mattfeld, Patrick
Trauth, Daniel
Hild, Rafael
[Journal Article]
Recommendations for Dry Forming of 16MnCr5 and 42CrMo4 in Cold Forging
In: Dry metal forming open access journal, 2, 44-49, 2016
[DOI: 10.18154/RWTH-2016-04874]
Klocke, Fritz
Hild, Rafael (Corresponding author)
Trauth, Daniel
Mattfeld, Patrick
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
[Journal Article]
Influence of the Composition on the Properties of (Cr 1-x Al x )N/Mo y S z PVD Coatings
In: Advanced engineering materials, 18 (6), 1036-1043, 2016
[DOI: 10.1002/adem.201500499]
Bobzin, Kirsten
Brögelmann, Tobias
Bastürk, Serhan (Corresponding author)
Klocke, Fritz
Mattfeld, Patrick
Trauth, Daniel
Polcik, Peter
Kolozsvári, Szilárd
[Journal Article]
In-Mould-Metal-Spraying - Surface and partial metallisation of plastic parts
In: European tool & mould making : ETMM, 18 (5), 38-39, 2016
Hopmann, Christian
Bobzin, Kirsten
Ochotta, Philipp (Corresponding author)
Öte, Mehmet
Knoch, Martin Andreas
Liao, Xifang
[Journal Article]
Modeling Multi-arc Spraying Systems
In: Journal of thermal spray technology, 25 (5), 920-932, 2016
[DOI: 10.1007/s11666-016-0407-7]
Bobzin, Kirsten
Öte, Mehmet (Corresponding author)
[Journal Article]
Improved molding of micro structures using PVD-coated mold inserts
In: Journal of Polymer Engineering, 36 (6), 575-582, 2015
[DOI: 10.1515/polyeng-2015-0270]
Hopmann, Christian
Bobzin, Kirsten
Brögelmann, Tobias
Schäfer, Christian
Schöngart, Maximilian
Röbig, Malte (Corresponding author)
Naderi, Mona
[Journal Article]
Wear and Corrosion Resistance of Fe-Based Coatings Reinforced by TiC Particles for Application in Hydraulic Systems
In: Journal of thermal spray technology, 25 (1), 365-374, 2015
[DOI: 10.1007/s11666-015-0316-1]
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik (Corresponding author)
Malik, Katarzyna
[Journal Article]
Influence of Process Parameter on Grit Blasting as a Pretreatment Process for Thermal Spraying
In: Journal of thermal spray technology, 25 (1), 3-11, 2015
[DOI: 10.1007/s11666-015-0297-0]
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Sommer, Jan
Liao, Xifang (Corresponding author)
[Journal Article]
IMKS and IMMS : two methods for the production of plastic parts featuring metallic areas
In: Journal of polymer engineering, 36 (6), 549-556, 2015
[DOI: 10.1515/polyeng-2014-0281]
Hopmann, Christian
Bobzin, Kirsten
Schoeldgen, Roman
Öte, Mehmet
Wunderle, Johannes
Linke, Thomas F.
Ochotta, Philipp (Corresponding author)
[Journal Article]
In-Mould-Metal-Spraying - Neuer Verfahrensansatz zur Metallisierung von Kunststoffbauteilen
In: Werkstoffe in der Fertigung, 52 (2), 16-17, 2015
Hopmann, Christian
Bobzin, Kirsten
Ochotta, Philipp
Öte, Mehmet
Linke, Thomas Frederik
Liao, Xifang
[Journal Article]
Aluminum-rich HPPMS (Cr1−xAlx)N coatings deposited with different target compositions and at various pulse lengths
In: Vacuum : surface engineering, surface instrumentation & vacuum technology, 122 (Part A), 201-207, 2015
[DOI: 10.1016/j.vacuum.2015.09.028]
Bobzin, Kirsten
Brögelmann, Tobias
Brugnara, R. H. (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
CrN/AlN and CrN/AlN/Al2O3 coatings deposited by pulsed cathodic arc for aluminum die casting applications
In: Surface and coatings technology, 284, 222-229, 2015
[DOI: 10.1016/j.surfcoat.2015.07.074]
Bobzin, Kirsten
Brögelmann, Tobias
Brugnara, R. H.
Kruppe, Nathan Christopher (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Analysis of ion energy distribution at the substrate during a HPPMS (Cr,Al)N process using retarding field energy analyzer and energy resolved mass spectrometer
In: Thin solid films, 596, 140-146, 2015
[DOI: 10.1016/j.tsf.2015.08.059]
Bobzin, Kirsten
Brögelmann, Tobias
Brugnara, Ricardo H.
Chromy, S. (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Investigation on Plastic Behavior of HPPMS CrN, AIN and CrN/AIN-Multilayer Coatings using Finite Element Simulation and Nanoindentation
In: Surface and coatings technology, 284, 310-317, 2015
[DOI: 10.1016/j.surfcoat.2015.07.081]
Bobzin, Kirsten
Brögelmann, Tobias
Brugnara, Ricardo H.
Arghavani, Mostafa (Corresponding author)
Yang, T.-S.
Chang, Y.-Y.
Chang, S.-Y.
[Contribution to a book, Journal Article]
Metallisierung von Kunststoffoberflächen - ein neues Verfahren: "In-Mould Metal Spraying (IMMS)"
In: Jahrbuch Oberflächentechnik, 71, 68-73, 2015
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Liao, Xifang
Hopmann, Christian
Ochotta, Philipp (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Influence of wetting and thermophysical properties of diamond-like carbon coatings on the frictional behavior in automobile gearboxes under elasto-hydrodynamic lubrication
In: Surface and coatings technology, 248, 290-301, 2015
[DOI: 10.1016/j.surfcoat.2015.06.087]
Bobzin, Kirsten
Brögelmann, Tobias (Corresponding author)
Stahl, Karsten
Stemplinger, Johann-Paul
Mayer, Josef
Hinterstoißer, M.
[Journal Article]
Application of thermal spraying for the manufacture of metal/plastic components
In: Thermal Spray Bulletin, 8 (1), 2-5, 2015
Bobzin, Kirsten
Liao, Xifang
Linke, Thomas Frederik
Öte, Mehmet
Hopmann, Christian
Ochotta, Philipp
[Journal Article]
Numerical Analysis of the Tribological Mode of Action in Cold Forming of Sinus Waved Surface Structures
In: Dry metal forming open access journal, 1, 137-142, 2015
Klocke, Fritz
Trauth, Daniel
Hild, Rafael (Corresponding author)
Mattfeld, Patrick
Bobzin, Kirsten
Brögelmann, Tobias
Bastürk, Serhan
[Journal Article]
Tribological Behavior of (Cr1-xAlc)N/WSy PVD Tool Coatings for the Application in Dry Cold Forging of Steel
In: Dry metal forming open access journal, 1, 152-158, 2015
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Bastürk, Serhan (Corresponding author)
Klocke, Fritz
Mattfeld, Patrick
Trauth, Daniel
[Contribution to a book, Journal Article]
Metallisierung von Kunststoffoberflächen - ein neues Verfahren: "In-Mould Metal Spraying (IMMS)"
In: Jahrbuch Oberflächentechnik, 71, 67-73, 2015
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Liao, Xifang
Hopmann, Christian
Ochotta, P.
[Journal Article]
Iron-based, titanium-carbide-reinforced thermally sprayed coatings for hydraulic systems
In: Thermal spray bulletin, 8 (2), 148-155, 2015
Bobzin, Kirsten (Corresponding author)
Öte, Mehmet (Corresponding author)
Linke, Frederik (Corresponding author)
Malik, Katarzyna
[Journal Article]
A Numerical Investigation : Air Plasma Spraying by Means of a Three-Cathode Spraying Torch
In: Thermal spray bulletin, 8 (2), 118-125, 2015
Bobzin, Kirsten
Öte, Mehmet
[Journal Article]
Hochleistungsplasmen zur Synthese diamantähnlicher Kohlenstoffschichten : Einfluss verschiedener Prozessgase und HPPMS-Pulsparameter auf die Plasmaeigenschaften
In: Vakuum in Forschung und Praxis, 27 (5), 22-28, 2015
[DOI: 10.1002/vipr.201500591]
Bobzin, Kirsten
Brögelmann, Tobias
Bastürk, Serhan
Engels, Martin Gottfried (Corresponding author)
[Journal Article]
Impulse geben : Kooperation für innovative Entwicklungen ; IOT und CemeCon
In: Facts / Deutsche Ausgabe, 41 (Juli), 9-10, 2015
Bobzin, Kirsten
Brögelmann, Tobias
Bastürk, Serhan
[Journal Article]
Laserunterstütztes Drehen von thermisch gespritzten WC-10Co-4Cr-Verschleißschutzschichten
In: Thermal spray bulletin, 8 (1), 43-49, 2015
Bobzin, Kirsten (Corresponding author)
Zhao, Lidong (Corresponding author)
Öte, Mehmet (Corresponding author)
Linke, Thomas Frederik (Corresponding author)
Klocke, Fritz
Gräfe, Stefan (Corresponding author)
Arntz, Kristian (Corresponding author)
Brummer, Christoph
[Journal Article]
Influence of surface treatment on the bond strength of plastics/metal hybrids
In: Zeitschrift Kunststofftechnik, 7, 228-255, 2015
Hopmann, Christian
Wunderle, Johannes
Neuß, Andreas
Ochotta, Philipp
Bobzin, Kirsten
Schulz, Christiane
Liao, Xifang
[Journal Article]
Wear behaviour of hydrogenated DLC in a pin-on-disc model test under lubrication with different diesel fuel types
In: Tribology international, 92, 12-20, 2015
[DOI: 10.1016/j.triboint.2015.05.020]
Djoufack, Martin H. (Corresponding author)
May, U.
Repphun, G.
Brögelmann, Tobias
Bobzin, Kirsten
[Journal Article]
Anwendungen des Thermischen Spritzens für die Herstellung von Metall-Kunststoff-Bauteilen
In: Thermal spray bulletin, 8, 28-31, 2015
Bobzin, Kirsten (Corresponding author)
Öte, Mehmet
Linke, Thomas Frederik
Liao, Xifang
Hopmann, Christian
Ochotta, Philipp
[Journal Article]
Multiscale FE-Studies of Contact Stresses of Dry and Lubricated Shot Peened Workpiece Surfaces
In: Dry metal forming open access journal, 1, 11-16, 2015
Klocke, Fritz
Trauth, Daniel (Corresponding author)
Mattfeld, Patrick
Shirobokov, Anton
Bobzin, Kirsten
Brögelmann, Tobias
Bastürk, Serhan
[Journal Article]
Development of an in situ Plasma Treatment of X155CrMoV12 for a (Cr,Al)N PVD Tool Coating for Dry Metal Forming in Cold Forging
In: Dry metal forming open access journal, 1, 57-62, 2015
Bobzin, Kirsten
Brögelmann, Tobias
Bastürk, Serhan (Corresponding author)
Klocke, Fritz
Mattfeld, Patrick
Trauth, Daniel
[Journal Article]
Friction reduction of highly-loaded rolling-sliding contacts by surface modifications under elasto-hydrodynamic lubrication
In: Wear, 328/329, 217-228, 2015
[DOI: 10.1016/j.wear.2015.02.033]
Bobzin, Kirsten
Brögelmann, Tobias (Corresponding author)
Stahl, K.
Michaelis, K.
Mayer, J.
Hinterstoißer, M.
[Contribution to a conference proceedings, Journal Article]
Deposition and characterization of thermal barrier coatings of ZrO2-4 mol.% Y2O3-1 mol.% Gd2O3-1 mol.% Yb2O3
In: Surface and coatings technology, 268, 205-208, 2014
[DOI: 10.1016/j.surfcoat.2014.05.051]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Öte, Mehmet
Linke, Thomas Frederik
[Journal Article]
Preparation of spherical calcium phosphate granulates suitable for the biofunctionalization of active brazed titanium alloy coatings
In: Biomedizinische Technik = Biomedical engineering, 60 (2), 105-114, 2014
[DOI: 10.1515/bmt-2014-0017]
Schickle, Karolina
Gerardo-Nava, Jose L. (Corresponding author)
Puidokas, Sabrina Michelle
Samadian Anavar, Sharareh
Bergmann, Christian
Gingter, Philipp
Schickle, Benjamin
Bobzin, Kirsten
Fischer, Horst
[Journal Article]
Corrosion of Wire Arc Sprayed ZnMgAl
In: Materials and corrosion = Werkstoffe und Korrosion, 66 (6), 520-526, 2015
[DOI: 10.1002/maco.201407601]
Bobzin, Kirsten
Öte, Mehmet
Linke, T. F.
Schulz, Christiane (Corresponding author)
[Journal Article]
Experimental and simulative strain field investigation of nano- and microscratches on nanolaminated (Cr, Al)N coating
In: Thin solid films, 573, 33-40, 2014
[DOI: 10.1016/j.tsf.2014.10.095]
Perne, Jan (Corresponding author)
[Journal Article]
Strukturen im Mikro-Format : Oberflächenstrukturen an PVD-Beschichteten Werkzeugeinsätze
In: Form + Werkzeug, Juni 2014, 65-65, 2014
Hopmann, Christian (Corresponding author)
Bobzin, Kirsten
Bagcivan, Nazlim
Brögelmann, Tobias
Schäfer, Christian
Schöngart, Maximilian
[Contribution to a conference proceedings, Journal Article]
Development of (Cr,Al)ON coatings using middle frequency magnetron sputtering and investigations on tribological behavior against polymers
In: Surface and coatings technology, 260, 347-361, 2014
[DOI: 10.1016/j.surfcoat.2014.09.016]
Bagcivan, Nazlim
Bobzin, Kirsten
Brögelmann, Tobias (Corresponding author)
Kalscheuer, Christian
[Contribution to a conference proceedings, Journal Article]
CrN/AlN nanolaminate coatings deposited via high power pulsed and middle frequency pulsed magnetron sputtering
In: Thin solid films, 572, 153-160, 2014
[DOI: 10.1016/j.tsf.2014.06.058]
Bagcivan, N.
Bobzin, Kirsten
Ludwig, A.
Grochla, D.
Brugnara, R. H. (Corresponding author)
[Contribution to a book, Journal Article]
Characterization of Reactive Air Brazed Ceramic/Metal Joints with Unadapted Thermal Expansion Behavior
In: Advanced engineering materials, 16 (12), 1490-1497, 2014
[DOI: 10.1002/adem.201400311]
Bobzin, Kirsten
Öte, Mehmet
Wiesner, Stefanie (Corresponding author)
Kaletsch, Anke
Broeckmann, Christoph
[Contribution to a book, Journal Article]
Influence of Filler and Base Material on the Pore Development during Reactive Air Brazing
In: Advanced engineering materials, 16 (12), 1456-1461, 2014
[DOI: 10.1002/adem.201400177]
Bobzin, Kirsten
Kopp, Nils
Wiesner, Stefanie (Corresponding author)
[Journal Article]
Tribological Evaluation of Hydrogenated DLC in Diesel Lubricated Diesel Model Test
In: Surface & coatings technology, 258, 381-391, 2014
[DOI: 10.1016/j.surfcoat.2014.08.065]
Djoufack, Martin (Corresponding author)
May, Ulrich
Bagcivan, Nazlim
Brögelmann, Tobias
Bobzin, Kirsten
[Contribution to a book, Journal Article]
Comparison of (Ti,Al)N and (Ti,Al)N/gamma-Al2O3 coatings regarding tribological behavior and machining performance
In: Surface & coatings technology, 257, 58-62, 2014
[DOI: 10.1016/j.surfcoat.2014.08.070]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, M.
Brugnara, R. H.
Bastürk, Serhan (Corresponding author)
[Journal Article]
High temperature corrosion behaviour of wire arc sprayed Fe based coatings
In: Surface engineering, 30 (8), 573-578, 2014
[DOI: 10.1179/1743294414Y.0000000287]
Li, R. (Corresponding author)
He, D. Y.
Zhou, Z.
Zhao, Lidong
Song, X. Y.
[Journal Article]
Microstructure behaviour and influence on thermally grown oxide formation of double-ceramic-layer EB-PVD thermal barrier coatings annealed at 1,300 °C under ambient isothermal conditions
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 45 (10), 879-893, 2014
[DOI: 10.1002/mawe.201400248]
Bobzin, Kirsten
Bagcivan, Nazlim
Brögelmann, Tobias
Yildirim, Baycan (Corresponding author)
[Journal Article]
Investigations of laser clad, thermal sprayed and laser remelted AlSi20-coatings on magnesium alloy AZ31B under constant and cycling thermal load
In: Surface & coatings technology, 259 (Pt. C), 751-758, 2014
[DOI: 10.1016/j.surfcoat.2014.09.049]
Rolink, Gesa (Corresponding author)
Weisheit, Andreas
Biermann, Tim
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Schulz, Christiane
Kelbassa, Ingomar
[Journal Article]
Einfluss der Wärmebehandlung auf Mikrostruktur und thermophysikalische Eigenschaften von Plasma gespritzten ZrO2-7%Y2O3- und La2Zr2O7-Schichten
In: Thermal spray bulletin, 7 (1), 43-49, 2014
Bobzin, Kirsten
Linke, Thomas Frederik
Zhao, Lidong
Erdogan, Garip
Üstel, Fatih
Öte, Mehmet
[Journal Article]
Emissions in Thermal Spraying : Development of a Suitable Test Method and Evaluation of Measurements in Laboratory as well as in Industrial Scale
In: Thermal spray bulletin, 7 (2), 136-141, 2014
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Dott, Wolfgang
Möller, Manfred
[Journal Article]
Erforschung Ti-Co-basierter, bioaktiver Auftraglötschichten auf oxidischen Hochleistungskeramiken in der Medizintechnik
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 45 (6), 504-511, 2014
[DOI: 10.1002/mawe.201400268]
Bobzin, Kirsten
Kopp, Nils
Wiesner, Stefanie
Puidokas, Sabrina Michelle
Samadian Anavar, Sharareh (Corresponding author)
Fischer, Horst
Korsten, Anne
Schickle, Karolina
[Journal Article]
Microstructure and high-temperature oxidation behavior of wire-arc sprayed Fe-based coatings
In: Surface & coatings technology, 251, 186-190, 2014
[DOI: 10.1016/j.surfcoat.2014.04.024]
Li, Ran (Corresponding author)
Zhou, Zheng
He, Dingyong
Zhao, Lidong
Song, Xiaoyan
[Contribution to a book, Journal Article]
Correlation between Chemical Glass Components and the Glass Sticking on Sputtered PtIr Physical Vapour Deposition Coatings for Precision Blank Moulding
In: Materials Sciences and Applications : MSA, 5, 316-329, 2014
[DOI: 10.4236/msa.2014.55037]
Bobzin, Kirsten
Bagcivan, Nazlim
Brögelmann, Tobias
Münstermann, Tobias
[Journal Article]
Plastic flow behavior of (Cr, Al) N hard coatings in dependence of strain rate and nanostructure
In: Thin solid films, 556, 390-394, 2014
[DOI: 10.1016/j.tsf.2014.01.069]
Perne, Jan (Corresponding author)
[Journal Article]
Influence of Ar/Kr ratio and pulse parameters in a Cr-N high power pulse magnetron sputtering process on plasma and coating properties
In: Journal of vacuum science & technology / A, Vacuum, surfaces, & films, 32 (2), 021513, 2014
[DOI: 10.1116/1.4865917]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Trieschmann, Jan
Brugnara, Ricardo H. (Corresponding author)
Preissing, Sven
Hecimovic, Ante
[Journal Article]
Wide Gap Active Brazing of Ceramic-to-Metal-Joints for High Temperature Applications
In: Frontiers of mechanical engineering in China, 9 (1), 71-74, 2014
[DOI: 10.1007/s11465-014-0291-0]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Kopp, Nils
Samadian Anavar, Sharareh
[Journal Article]
Systematische Untersuchung der Eigenschaften gelöteter Fügeverbunde mit anwendungsrelevanten Prüfverfahren
In: Schweißen und Schneiden, 65 (5), 254-261, 2013
Bobzin, Kirsten
Kopp, Nils
Puidokas, Sabrina Michelle
Tillmann, Wolfgang
Wojarski, Lukas
Liu, C.
Manka, Matthias
[Journal Article]
Einsatz von PVD-Beschichtungen zur Verschleißreduzierung im tribologischen System Pumpe
In: Tribologie und Schmierungstechnik, 61, 5-13, 2013
Bobzin, Kirsten (Corresponding author)
Bagcivan, Nazlim
Brögelmann, Tobias
Sauter, K.
Wegener, T.
[Journal Article]
Einfluss von Lot- und Grundwerkstoffen auf die Porosität mittels "Reactive Air Brazing" gelöteter Keramik-Keramik- und Keramik-Metall-Verbindungen
In: Schweissen und Schneiden, 65 (12), 838-842, 2013
Bobzin, Kirsten
Kopp, Nils
Wiesner, Stefanie
[Journal Article]
Wear and high-temperature corrosion behavior of a wire-arc sprayed NiCrB coating
In: Thermal spray bulletin, 2013 (1), 48, 2013
Zhou, Z.
Bobzin, Kirsten
He, D. Y.
Zhao, Lidong
Zhao, X. Z.
Kopp, Nils
Zhao, Q. Y.
Li, R. S.
[Journal Article]
Surface chemistry of PVD (Cr,Al)N coatings deposited by means of direct current and high power pulsed magnetron sputtering
In: Surface and interface analysis : Sia, 45 (13), 1884-1892, 2013
[DOI: 10.1002/sia.5336]
Kunze, Christian
Brugnara, Ricardo H.
Bagcivan, Nazlim
Bobzin, Kirsten
Grundmeier, Guido (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Influence of temperature on phase stability and thermal conductivity of single- and double-ceramic-layer EB-PVD TBC top coats consisting of 7YSZ, Gd2Zr2O7 and La2Zr2O7
In: Surface & coatings technology, 237, 56-64, 2013
[DOI: 10.1016/j.surfcoat.2013.08.013]
Bobzin, Kirsten
Bagcivan, Nazlim
Brögelmann, Tobias
Yildirim, Baycan (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Continuum and kinetic simulations of the neutral gas flow in an industrial physical vapor deposition reactor
In: Surface & coatings technology, 237, 176-181, 2013
[DOI: 10.1016/j.surfcoat.2013.08.018]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Brugnara, Ricardo H.
Schäfer, Marcel Pascal
Brinkmann, Ralf Peter
Mussenbrock, Thomas
Trieschmann, Jan (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Influence of Application Technology on the Erosion Resistance of DLC coatings
In: Surface & coatings technology, 237, 284-291, 2013
[DOI: 10.1016/j.surfcoat.2013.07.043]
Depner-Miller, U. (Corresponding author)
Ellermeier, J.
Scheerer, H.
Oechsner, Matthias
Bobzin, Kirsten
Bagcivan, Nazlim
Brögelmann, Tobias
Weiss, R.
Durst, K.
Schmid, C.
[Contribution to a conference proceedings, Journal Article]
Influence of HPPMS pulse length and inert gas mixture on the properties of (Cr,Al)N coatings
In: Thin solid films, 549, 192-198, 2013
[DOI: 10.1016/j.tsf.2013.06.036]
Bagcivan, Nazlim
Bobzin, Kirsten
Grundmeier, G.
Wiesing, M.
Ozcan, O.
Kunze, C.
Brugnara, Ricardo H. (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Flow curve determination of thin films by improved finite element models and different nanoindenter geometries
In: Thin solid films, 549, 313-320, 2013
[DOI: 10.1016/j.tsf.2013.06.037]
Bobzin, Kirsten
Bagcivan, N.
Brugnara, R. H.
Perne, J. (Corresponding author)
[Contribution to a book, Journal Article]
Vereinfachte Berechnung der Mikrostruktur zur Ableitung der Schichteigenschaften im thermischen Spritzen
In: Jahrbuch Oberflächentechnik, 69, 139-154, 2013
Bobzin, Kirsten
Kopp, Nils
Linke, Thomas Frederik
Schäfer, Marcel Pascal
[Contribution to a conference proceedings, Journal Article]
Investigation of the Properties of Low Temperature (Cr1-xAlx)N Coatings Deposited via Hybrid PVD DC-MSIP/HPPMS
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (8), 667-672, 2013
[DOI: 10.1002/mawe.201300173]
Bobzin, Kirsten
Bagcivan, Nazlim
Brugnara, Ricardo H. (Corresponding author)
[Journal Article]
Approach to determine stress strain curves by FEM supported nanoindentation
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (6), 571-576, 2013
[DOI: 10.1002/mawe.201300099]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Brugnara, Ricardo H.
Perne, Jan (Corresponding author)
[Journal Article]
Thermal stability of silicon-doped Al2O3 PVD coatings
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (8), 679-683, 2013
[DOI: 10.1002/mawe.201300175]
Bobzin, Kirsten
Bagcivan, Nazlim
Müller, M.
Ewering, Mara Therese
Brugnara, Ricardo H. (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Development and qualification of a MSIP PVD iridium coating for precision glass moulding
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (8), 673-678, 2013
[DOI: 10.1002/mawe.201300174]
Bobzin, Kirsten
Bagcivan, Nazlim
Brögelmann, Tobias
Münstermann, Tobias (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Improvement of Coating Properties in Three-Cathode Atmospheric Plasma Spraying
In: Journal of thermal spray technology : JTST, 22 (4), 502-508, 2013
[DOI: 10.1007/s11666-013-9902-2]
Bobzin, Kirsten
Kopp, Nils
Warda, Thomas
Petkovic, Ivica
Zimmermann, S. (Corresponding author)
Hartz-Behrend, K.
Landes, K.
Forster, G.
Kirner, S.
Marqués, J.-L.
Schein, J.
Prehm, J. (Corresponding author)
Möhwald, K.
Bach, Fr.-W.
[Journal Article]
Synthesis of nano-structured HPPMS CrN/AlN coatings
In: Journal of physics / D, Applied physics, 46 (8), 084001, 2013
[DOI: 10.1088/0022-3727/46/8/084001]
Bagcivan, Nazlim
Bobzin, Kirsten
Theiß, Sebastian
[Journal Article]
Flow curve determination on dc-MS and HPPMS CrAlN coatings
In: Journal of physics / D, Applied physics, 46 (8), 084006, 2013
[DOI: 10.1088/0022-3727/46/8/084006]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Perne, Jan (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Particle In-Flight and Coating Properties of Fe-Based Feedstock Materials Sprayed with Modern Thermal Spray Systems
In: Journal of thermal spray technology : JTST, 22 (2/3), 363-370, 2013
[DOI: 10.1007/s11666-012-9853-z]
Bobzin, Kirsten
Kopp, Nils
Warda, Thomas (Corresponding author)
Petkovic, Ivica
Schaefer, Marcel
Landes, Klaus
Forster, Günter
Zimmermann, Stephan
Marques, Jose-Luis
Kirner, Stefan
Kauffeldt, Marina
Schein, Jochen
[Contribution to a conference proceedings, Journal Article]
(Cr1-xAlx)N : A comparison of direct current, middle frequency pulsed and high power pulsed magnetron sputtering for injection molding components
In: Thin solid films, 528, 180-186, 2013
[DOI: 10.1016/j.tsf.2012.08.056]
Bagcivan, Nazlim
Bobzin, Kirsten
Theiß, Sebastian (Corresponding author)
[Contribution to a conference proceedings, Journal Article]
Behavior of DLC coated low-alloy steel under tribological and corrosive load : Effect of top layer and interlayer variation
In: Surface & coatings technology, 215, 110-118, 2013
[DOI: 10.1016/j.surfcoat.2012.08.075]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Weiß, Raphael (Corresponding author)
Depner, Udo
Trossmann, Torsten
Ellermeier, Jörg
Oechsner, Matthias
[Journal Article]
Stellenwert des Plasmaspritzens unter den thermischen Spritzverfahren
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 103 (11), 2384-2395, 2012
Bobzin, Kirsten
Warda, Thomas
Brühl, Markus
[Journal Article]
Improving Contour Accuracy and Strength of Reactive Air Brazed (RAB) Ceramic/Metal Joints by Controlling Interface Microstructure
In: Advanced engineering materials, 14 (6), 394-399, 2012
[DOI: 10.1002/adem.201100274]
Li, Chichi
Kuhn, Bernd
Brandenberg, Jörg
Beck, Tilmann
Singheiser, Lorenz
Bobzin, Kirsten
Bagcivan, Nazlim
Kopp, Nils
[Journal Article]
Feasibility study of plasma sprayed Al2O3 coatings as diffusion barrier on CFC components
In: Frontiers of Mechanical Engineering, 7 (4), 371-375, 2012
[DOI: 10.1007/s11465-012-0339-y]
Bobzin, Kirsten
Zhao, Lidong
Kopp, Nils
Warda, Thomas
[Journal Article]
Thermisch gespritzte Korrosionsschutzschichten auf Zink-Basis als Ergänzung zum Stückverzinken von Bauteilen
In: Thermal spray bulletin, 5 (1), 48-55, 2012
Bobzin, Kirsten
Kopp, Nils
Warda, Thomas
Schulz, Christiane
Klesen, Christian
Poller, Benjamin
Ingendahl, Tobias
[Journal Article]
Determination of the Effective Properties of Thermal Spray Coatings Using 2D and 3D Models
In: Journal of thermal spray technology : JTST, 21 (6), 1269-1277, 2012
[DOI: 10.1007/s11666-012-9809-3]
Bobzin, Kirsten
Kopp, Nils
Warda, Thomas
Öte, Mehmet
[Journal Article]
Extrusion embossing of hydrophobic films - a study on process characteristics and surface properties
In: Zeitschrift Kunststofftechnik = Journal of plastics technology, 8 (3), 302-330, 2012
Hopmann, Christian
Michaeli, Walter
Eilbracht, Stephan
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Hartmann, Claudia
Holtkamp, Jens
Gillner, Arnold
Mayer, Joachim
[Journal Article]
Investigation of wear and corrosion protection of AlSi20 coatings produced by thermal spraying and laser cladding on AZ31B
In: Journal of thermal spray technology : JTST, 22 (2/3), 207-212, 2012
[DOI: 10.1007/s11666-012-9867-6]
Bobzin, Kirsten
Kopp, Nils
Warda, Thomas
Schulz, Christiane (Corresponding author)
Rolink, Gesa
Weisheit, Andreas
[Contribution to a conference proceedings, Journal Article]
Comparison of (Cr0.75Al0.25)N Coatings Deposited by Conventional and High Power Pulsed Magnetron Sputtering
In: Contributions to plasma physics : CPP, 52 (7), 601-606, 2012
[DOI: 10.1002/ctpp.201210056]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
[Journal Article]
Influence of interlayer thickness of a thin noble metal MSIP-PVD coating on compound and system properties for glass lens moulding
In: Production engineering, 6 (3), 311-318, 2012
[DOI: 10.1007/s11740-012-0385-7]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Brugnara, Ricardo H.
Münstermann, Tobias
[Journal Article]
Vanadium Alloyed PVD CrAlN Coatings for Friction Reduction in Metal Forming Applications
In: Tribology in Industry, 34 (2), 101-107, 2012
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Brugnara, Ricardo H.
[Journal Article]
Influence of the Layer Architecture of DLC Coatings on their Wear and Corrosion Resistance
In: International journal of materials research : IJMR, 103 (6), 774-782, 2012
[DOI: 10.3139/146.110763]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Weiß, Raphael
Troßmann, Torsten
Ellermeier, Jörg
Oechsner, Matthias
Depner, Udo
[Journal Article]
Kraftstoffersparnis durch Hochleistungswerkstoffe
In: Vakuum in Forschung und Praxis : VIP, 24 (2), 35-38, 2012
[DOI: 10.1002/vipr.201200487]
Bobzin, Kirsten
Bagcivan, Nazlim
Verpoort, Clemens
Schramm, Leander
Yilmaz, Koray
Theiß, Sebastian (Corresponding author)
[Journal Article]
Development of an integrative simulation method to predict the microstructural influence on the mechanical behaviour of semi-crystalline thermoplastic parts
In: International journal of materials research : IJMR, 103 (1), 120-130, 2012
[DOI: 10.3139/146.110628]
Michaeli, Walter
Hopmann, Christian
Bobzin, Kirsten
Arping, Tim Wilhelm
Baranowski, Thomas
Heesel, Barbara
Laschet, Gottfried
Schläfer, Thomas
Öte, Mehmet
[Journal Article]
Application of variothermal heating concepts for the production of micro-structured films using the extrusion embossing process
In: Journal of polymer engineering, 32 (2), 95-101, 2012
[DOI: 10.1515/polyeng-2012-0502]
Michaeli, Walter
Eilbracht, Stephan
Scharf, Micha Christian
Hartmann, Claudia
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
[Journal Article]
Ultrasonic welding of hybrid metal-plastic components with flame spraying of adhesion layer
In: Zeitschrift Kunststofftechnik, 7, 161-177, 2011
Flock, Dustin (Corresponding author)
Haberstroh, Edmund
Bobzin, Kirsten
Schläfer, Thomas
Warda, Thomas
Kutschmann, Pia
[Journal Article]
Development of oxide based diffusion barrier coatings for CFC components applied in modern furnaces
In: Frontiers of Mechanical Engineering, 6 (4), 392-396, 2011
[DOI: 10.1007/s11465-011-0241-z]
Bobzin, Kirsten
Zhao, Lidong
Schläfer, Thomas
Warda, Thomas
[Journal Article]
HPPMS coatings for metal deformation tools
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 102 (5), 1150-1157, 2011
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Brugnara, Ricardo H.
[Journal Article]
Preparation and characterization of nanocrystalline ZrO2-7%Y2O3 powders for thermal barrier coatings by high-energy ball milling
In: Frontiers of Mechanical Engineering, 6 (2), 176-181, 2011
[DOI: 10.1007/s11465-011-0220-4]
Bobzin, Kirsten
Zhao, Lidong
Schläfer, Thomas
Warda, Thomas
[Journal Article]
Crystalline γ-Al2O3 Physical Vapour Deposition-Coating for Steel Thixoforging Tools
In: Journal of nanoscience and nanotechnology, 11 (10), 8782-8785, 2011
[DOI: 10.1166/jnn.2011.3469]
Bobzin, Kirsten
Hirt, Gerhard
Bagcivan, Nazlim
Khizhnyakova, Liudmila
Ewering, Mara Therese
[Journal Article]
Improving Long Term Oxidation Protection for Gamma-TiAl Substrates
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 42 (11), 1013-1018, 2011
[DOI: 10.1002/mawe.201100827]
Bobzin, Kirsten
Linke, Thomas Frederik
Brühl, Markus
Warda, Thomas
Schläfer, Thomas
[Journal Article]
Optimisation of an HVOF process using simulation techniques
In: Thermal spray bulletin, 2, 159-164, 2011
Bobzin, Kirsten
Schläfer, Thomas
Schäfer, Marcel Pascal
[Journal Article]
Wear behavior of HPPMS deposited (Ti,Al,Si)N coating under impact loading
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 42 (3), 165-171, 2011
[DOI: 10.1002/mawe.201100771]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Theiß, Sebastian
[Contribution to a conference proceedings, Journal Article]
Hydrogen content variation for enhancing the lubricated tribological performance of DLC coatings with ester
In: Surface & coatings technology, 205 (Suppl. 2), 89-93, 2011
[DOI: 10.1016/j.surfcoat.2011.02.065]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Yilmaz, Koray
[Journal Article]
Die Entwicklung des Breitspaltaktivlötens als neue Fügetechnologie für Keramik-Metall-Mischverbunde mit Einsatztemperaturen oberhalb 500 °C
In: Keramische Zeitschrift, 63 (5), 329-333, 2011
Schlegel, Arne
Bobzin, Kirsten
Kopp, Nils
Bagcivan, Nazlim
[Journal Article]
Thermochemistry of brazing ceramics and metals in air
In: International journal of materials research : IJMR, 8 (08), 972-976, 2011
[DOI: 10.3139/146.110550]
Bobzin, Kirsten
Schläfer, Thomas
Kopp, Nils
[Journal Article]
Nachbearbeitungsarme Fe-Basis-Feinstpulverschichtenzum kostengünstigen Korrosionsund Verschleißschutz
In: Thermal spray bulletin, 4 (2), 139-146, 2011
Bobzin, Kirsten
Schläfer, Thomas
Warda, Thomas
Schäfer, Marcel Pascal
[Journal Article]
Injection molding of products with functional surfaces by micro-structured, PVD coated injection molds
In: Production engineering, 5 (4), 415-422, 2011
[DOI: 10.1007/s11740-011-0319-9]
Bobzin, Kirsten
Bagcivan, Nazlim
Gillner, Arnold
Hartmann, Claudia
Holtkamp, Jens
Michaeli, Walter
Klaiber, Fritz
Schöngart, Maximilian
Theiß, Sebastian
[Journal Article]
PVD-beschichteteWälzlager im Trockenlauf
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 42 (11), 1025-1034, 2011
[DOI: 10.1002/mawe.201100847]
Jacobs, Georg
Rombach, Volker
Plogmann, Michael
van Lier, Hermann
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Weiß, Raphael (Corresponding author)
[Journal Article]
In-Vitro Study of Microplasma Sprayed Hydroxyapatite Coatings in Hanks Balanced Salt Solution
In: Materials and manufacturing processes, 26 (2), 175-180, 2011
[DOI: 10.1080/10426914.2010.498071]
Zhao, Qiuying
He, Dingyong
Zhao, Lidong
Li, Xiaoyan
[Journal Article]
Replication of specifially microstructured surfaces in A356-alloy via lost wax investment casting
In: Journal of micromechanics and microengineering, 21 (8), 085026, 2011
[DOI: 10.1088/0960-1317/21/8/085026]
Ivanov, Todor
Bührig-Polaczek, Andreas
Vroomen, Uwe
Hartmann, Claudia
Holtkamp, Jens
Gillner, Arnold
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
[Journal Article]
Numerical and experimental determination of plasma temperature during air plasma spraying with a multiple cathodes torch
In: Journal of materials processing technology, 211 (10), 1620-1628, 2011
[DOI: 10.1016/j.jmatprotec.2011.05.001]
Bobzin, Kirsten
Bagcivan, Nazlim
Petkovic, Ivica
[Journal Article]
Modelling and diagnostics of multiple cathodes plasma torch system for plasma spraying
In: Frontiers of Mechanical Engineering, 6 (3), 324-331, 2011
[DOI: 10.1007/s11465-011-0125-2]
Bobzin, Kirsten
Bagcivan, Nazlim
Zhao, Lidong
Petkovic, Ivica
Schein, Jochen
Hartz-Behrend, Karsten
Kirner, Stefan
Marqués, José-Luis
Forster, Günter
[Journal Article]
DC-MSIP/HPPMS (Cr,Al,V)N and (Cr,Al,W)N thin films for high-temperature friction reduction
In: Surface & coatings technology, 205 (8/9), 2887-2892, 2011
[DOI: 10.1016/j.surfcoat.2010.10.056]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Brugnara, Ricardo H.
Theiß, Sebastian
[Journal Article]
A Strong Connection of Unequal Partners [Joining method ]
In: Kunststoffe / Kunststoffe international, 100 (11), 50-53, 2010
Flock, Dustin
Haberstroh, Edmund
Rosner, A.
Gillner, Arnold
Poprawe, N. R.
Theiß, Sebastian
Bagcivan, Nazlim
Bobzin, Kirsten
Wagner, Nikolaus
Olschok, Simon
Reisgen, Uwe
[Journal Article]
Characterisation of plasma-sprayed SrFe12O19 coatings for electromagnetic wave absorption
In: Journal of the European Ceramic Society, 31 (8), 1439-1449, 2010
[DOI: 10.1016/j.jeurceramsoc.2011.02.003]
Bobzin, Kirsten
Bolelli, Giovanni
Brühl, Markus
Hujanen, Arto
Lintunen, Pertti
Lisjak, Darja
Gyergyek, Sašo
Lusvarghi, Luca
[Journal Article]
Entwicklung von neuen Aktivlotpulvern auf Basis kommerzieller Nickellote mit Zirkon als Aktivelement zum Fügen von Keramik-Metall-Verbunden
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 41 (6), 455-463, 2010
[DOI: 10.1002/mawe.201000627]
Bobzin, Kirsten
Schläfer, Thomas
Kopp, Nils
Schlegel, Arne
[Journal Article]
Deposition of High-Quality NiCoCrAlTaReSiY Oxidation Resistance Coatings by HVOF
In: Xiyou-jinshu-cailiao-yu-gongcheng = Rare metal materials and engineering, 39 (11), 2027-2029, 2010
Wang, Kaisheng
Zhao, Lidong
Zhao, Zhimin
[Journal Article]
Systematische Untersuchung der Verbindungseigenschaften von Lötungen mit Ag-, Cu-, Au- und Ni-Basisloten mit anwendungsrelevanten Prüfverfahren
In: Schweissen und Schneiden, 62 (5), 256-263, 2010
Bobzin, Kirsten
Schläfer, Thomas
Kopp, Nils
Puidokas, Sabrina Michelle
Tillmann, Walter
Osmanda, Artur Martin
Wojarski, Lukas
[Journal Article]
Untersuchung und Bewertung der Fehlergrößen im Haftzugversuch nach DIN EN 582
In: Thermal spray bulletin, 3 (1), 30-36, 2010
Bobzin, Kirsten
Schläfer, Thomas
Aumund-Kopp, Claus
[Journal Article]
Calculation of effective properties of textile reinforced aluminum alloy by a two-step homogenization procedure
In: Computational materials science, 47 (3), 801-806, 2010
[DOI: 10.1016/j.commatsci.2009.11.007]
Bobzin, Kirsten
Bagcivan, Nazlim
Parkot, Daniel
Kashko, Tatyana
[Journal Article]
Hexaferrite/Polyester Composite Coatings for Electromagnetic-Wave Absorbers
In: Journal of thermal spray technology : JTST, 20 (3), 638-644, 2010
[DOI: 10.1007/s11666-010-9607-8]
Lisjak, Darja
Bégard, Marion
Brühl, Markus
Bobzin, Kirsten
Hujanen, Arto
Lintunen, Pertti
Bolelli, Giovanni
Lusvarghi, Luca
Ovtar, Simona
Drofenik, Miha
[Journal Article]
HPPMS-Beschichtung für Umformwerkzeuge
In: Jahrbuch Oberflächentechnik, 66, 88-95, 2010
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Brugnara, Ricardo H.
[Contribution to a book, Contribution to a conference proceedings, Journal Article]
Impact Behaviour of PtIr-based Coatings with Different Interlayers for Glass Lens Moulding
In: Key engineering materials, 438, 57-64, 2010
[DOI: 10.4028/www.scientific.net/KEM.438.57]
Bobzin, Kirsten
Klocke, Fritz
Bagcivan, Nazlim
Ewering, Mara Therese
Georgiadis, Kyriakos
Münstermann, Tobias
[Contribution to a conference proceedings, Journal Article]
Thermal stability of [gamma]-Al2O3 coatings for challenging cutting operations
In: Surface & coatings technology, 205 (5), 1444-1448, 2010
[DOI: 10.1016/j.surfcoat.2010.07.040]
Bobzin, Kirsten
Bagcivan, Nazlim
Reinholdt, Alexander
Ewering, Mara Therese
[Contribution to a conference proceedings, Journal Article]
Plasma coatings CrAlN and a-C:H for high efficient power train in automobile
In: Surface & coatings technology, 205 (5), 1502-1507, 2010
[DOI: 10.1016/j.surfcoat.2010.08.108]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Yilmaz, Koray
[Journal Article]
Hartstoffschichten der Zukunft : Oxidische Schichten und HPPMS-Schichten für anspruchsvolle Zerspanaufgaben
In: Vakuum in Forschung und Praxis : VIP, 22 (6), 31-35, 2010
[DOI: 10.1002/vipr.201000437]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
[Journal Article]
Metal flow and die wear in semi-solid forging of steel using coated dies
In: Transactions of Nonferrous Metals Society of China : english edition, 20 (Supplement 3), 954-960, 2010
[DOI: 10.1016/s1003-6326(10)60613-9]
Khizhnyakova, L.
Ewering, Mara Therese
Hirt, Gerhard
Bobzin, Kirsten
Bagcivan, Nazlim
[Journal Article]
Influence of the filler materials on flux-free brazing of pure aluminium (1050)
In: Frontiers of mechanical engineering in China, 5 (1), 47-51, 2010
[DOI: 10.1007/s11465-009-0079-9]
Bobzin, Kirsten
Zhao, Lidong
Schläfer, Thomas
Warda, Thomas
[Journal Article]
Application of cold spraying for flux-free brazing of aluminium alloy 6060
In: Frontiers of mechanical engineering in China, 5 (3), 256-260, 2010
[DOI: 10.1007/s11465-010-0095-9]
Bobzin, Kirsten
Zhao, Lidong
Schläfer, Thomas
Warda, Thomas
[Contribution to a conference proceedings, Journal Article]
Semi-solid forming of non axis-symmetric parts from steel grade X210CrW12 with PVD coated tools
In: International journal of material forming, 3 (1), 731-734, 2010
[DOI: 10.1007/s12289-010-0874-1]
Hirt, Gerhard
Bobzin, Kirsten
Khizhnyakova, Liudmila
Ewering, Mara Therese
Bagcivan, Nazlim
[Contribution to a conference proceedings, Journal Article]
Development of Ba-hexaferrite coatings for electromagnetic wave absorption applications
In: Surface & coatings technology, 205 (4), 1015-1020, 2010
[DOI: 10.1016/j.surfcoat.2010.03.060]
Bobzin, Kirsten
Schläfer, Thomas
Bégard, Marion
Brühl, Markus
Bolelli, Giovanni
Lusvarghi, Luca
Lisjak, Darja
Hujanen, Arto
Lintunen, Pertti
Kanerva, Ulla
Varis, Tommi
Pasquale, Massimo
[Journal Article]
Magnetic Phase Formation in CoTi-Substituted Ba Hexaferrite Coatings Prepared with Atmospheric Plasma Spraying
In: Journal of the American Ceramic Society, 93 (9), 2579-2584, 2010
[DOI: 10.1111/j.1551-2916.2010.03770.x]
Lisjak, Darja
Bolelli, Giovanni
Lusvarghi, Luca
Bégard, Marion
Brühl, Markus
Bobzin, Kirsten
Lintunen, Pertti
Kanerva, Ulla
Pasquale, Massimo
Drofenik, Miha
[Journal Article]
Starke Verbindung ungleicher Partner
In: Kunststoffe / [Deutsche Ausgabe], 11 (112), 60-63, 2010
Flock, Dustin
Haberstroh, Edmund
Rösner, Andreas
Gillner, Arnold
Poprawe, Reinhart
Theiß, Sebastian
Bagcivan, Nazlim
Bobzin, Kirsten
Wagner, Nikolaus
Olschok, Simon
Reisgen, Uwe
[Journal Article]
Development of PVD coatings for application of zinc die casting
In: International foundry research, 62 (10), 8-14, 2010
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
[Journal Article]
Development of new transient liquid phase system Au-Sn-Au for microsystem technology
In: Frontiers of mechanical engineering in China, 5 (4), 370-375, 2010
[DOI: 10.1007/s11465-010-0107-9]
Bobzin, Kirsten
Bagcivan, Nazlim
Zhao, Lidong
Ferrara, Stefania
Perne, Jan
[Journal Article]
Brazing of ceramic-to-ceramic and ceramic-to-metal joints in air
In: Frontiers of mechanical engineering in China, 5 (2), 125-129, 2010
[DOI: 10.1007/s11465-010-0007-z]
Bobzin, Kirsten
Schläfer, Thomas
Zhao, Lidong
Kopp, Nils
Schlegel, Arne
[Journal Article]
Lotus-Effekt für Massenprodukte : Mikrostrukturierte Kunststoffbauteile durch Abformen eines Werkzeuges herstellen
In: Der Plastverarbeiter : PV, 2010 (9), 104-106, 2010
Bagcivan, Nazlim
Bobzin, Kirsten
Eilbracht, Stephan
Gillner, Arnold
Hartmann, Claudia
Klaiber, Fritz
Michaeli, Walter
Scharf, Micha Christian
Theiß, Sebastian
[Journal Article]
Environmentally friendly tribological systems in axial piston machines
In: Tribologie und Schmierungstechnik, 57 (3), 27-31, 2010
Murrenhoff, Hubertus
Enekes, Claus Peter
Gold, Peter Werner
Jacobs, Georg
Rombach, Volker
Plogmann, Michael
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Göbbels, Nico
[Journal Article]
Influence of different pulse parameters on the deposition of Al2O3
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 41 (8), 670-674, 2010
[DOI: 10.1002/mawe.201000653]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
[Journal Article]
Hot Forging of C45 using PVD (Ti,Al)N/γ-Al2O3 Coated Dies
In: Steel research international, 81 (7), 603-609, 2010
[DOI: 10.1002/srin.201000031]
Bobzin, Kirsten
Hirt, Gerhard
Springorum, F.
Zitz, U.
Steinhof, N.
Bagcivan, Nazlim
Baadjou, René
Ewering, Mara Therese
Immich, Philipp
[Journal Article]
Development of NiZn-Ferrite Coatings for Electromagnetic Applications
In: Welding and cutting, 9 (2), 111-116, 2010
Talaka, Tatiana
Ilyuschencko, Alexander
Weil, Carsten
Linden, Ismo
McCartney, Graham
Zhang, Deen
Yellup, John Y.
Brühl, Markus
Bobzin, Kirsten
[Journal Article]
Understanding HPPMS PVD
In: Europhysics news, 41 (3), 14-15, 2010
Theiß, Sebastian
Bibinov, N.
Bagcivan, Nazlim
Ewering, Mara Therese
Awakowicz, Peter
Bobzin, Kirsten
[Abstract, Journal Article]
Time resolved optical emission spectroscopy of an HPPMS coating process
In: Journal of physics / D, Applied physics, 43 (7), 8-8, 2010
[DOI: 10.1088/0022-3727/43/7/075205]
Theiß, Sebastian
Bibinov, Nikita
Bagcivan, Nazlim
Ewering, Mara Therese
Awakowicz, Peter
Bobzin, Kirsten
[Journal Article]
Microstructure and complex magnetic permeability of thermally sprayed NiZn ferrite coatings for electromagnetic wave absorbers
In: Surface engineering, 26 (6), 484-490, 2010
[DOI: 10.1179/026708410X12687356948634]
Brühl, Markus
Zhang, Deen
Talaka, Tatiana
Weil, Carsten
Linden, Ismo
Bobzin, Kirsten
Ilyuschencko, Alexander
McCartney, Graham
Yellup, John Y.
[Journal Article]
Crystalline γ-Alumina Deposited in an Industrial Coating Unit for Demanding Turning Operations
In: Advanced engineering materials, 12 (1/2), 75-79, 2010
[DOI: 10.1002/adem.200900232]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
[Journal Article]
Modeling of Coating Process, Phase Changes, and Damage of Plasma Sprayed Thermal Barrier Coatings on Ni-Base Superalloys
In: Advanced engineering materials, 12 (3), 110-126, 2009
[DOI: 10.1002/adem.201000023]
Beck, Tilmann
Bialas, Marcin
Bednarz, Piotr
Singheiser, Lorenz
Bobzin, Kirsten
Bagcivan, Nazlim
Parkot, Daniel
Kashko, Tatyana
Petkovic, Jvica
Hallstedt, Bengt
Nemna, Sergey
Schneider, Jochen M.
[Journal Article]
Simulation of PYSZ particle impact and solidification in atmospheric plasma spraying coating process
In: Surface & coatings technology, 204 (8), 1211-1215, 2010
[DOI: 10.1016/j.surfcoat.2009.10.028]
Bobzin, Kirsten
Bagcivan, Nazlim
Parkot, Daniel
Petkovic, Ivica
[Journal Article]
Microstructure and properties of HVOF sprayed AP40 bioactive glass-ceramic coatings
In: Beijing-Gongye-Daxue-xuebao : jikan = Journal of Beijing University of Technology, 35 (3), 374-377, 2009
Ding-Yong, He
Li-Dong, Zhao
[Abstract, Contribution to a conference proceedings, Journal Article]
Modified plastic surfaces for growth of adherent cells, localized genetic modification and cell selection
In: Human gene therapy, 20 (11), 1436-1436, 2009
Meyring, Wilhelm
Schoen, Oliver
Zghoul, Nadia
Pohl, Susanne
Dohse, Antje
Thomas, Michael
Garritsen, Henk
Woermann, Bernhard
Dittmar, Kurt
Lindenmaier, Werner
[Contribution to a conference proceedings, Journal Article]
Impact behavior of (Ti,Al,Si)N deposited by HPPMS
In: Thin solid films, 518 (5), H2-2-7, 2009
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Theiß, Sebastian
Bolz, Stephan Frédéric
[Journal Article]
Crystalline y-Al2O3 Coating for Steel Thixoforging Tools
In: Journal of nanoscience and nanotechnology, 9 (Special issue), 2009
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Khizhnyakova, Luidmila
[Journal Article]
Challenging gold based filler metals for uses in medicine
In: Materials science and technology : MST, 25 (12), 1422-1431, 2009
[DOI: 10.1179/174328407X226590]
Bobzin, Kirsten
Lugscheider, Erich
Ernst, F.
Rösing, J.
Ferrara, S.
[Journal Article]
Entwicklung von Diffusionssperrschichten für CFC-Bauteile mittels thermischer Spritztechnik
In: Thermal spray bulletin, 2 (1), 34-38, 2009
Bobzin, Kirsten
Zhao, Lidong
Schläfer, Thomas
Warda, Thomas
[Journal Article]
Influence of the definition of the representative volume element on the effective thermoelastic properties of thermal barrier coatings with random microstructure
In: Journal of thermal spray technology : JTST, 18 (5/6), 988-995, 2009
[DOI: 10.1007/s11666-009-9351-0]
Bobzin, Kirsten
Bagcivan, Nazlim
Parkot, Daniel
Kashko, Tatyana
Laschet, Gottfried
Scheele, Josef
[Journal Article]
Surface-brazed wear protection systems for titanium alloys
In: Welding and cutting, 8 (4), 211-213, 2009
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Schlegel, Arne
Kopp, Nils
[Journal Article]
Skalenübergreifende Simulation teilkristalliner Thermoplaste
In: Werkstoffe in der Fertigung : die Fachzeitschrift für technische Führungskräfte, 2009 (5), 33-34, 2009
Michaeli, Walter
Baranowski, Thomas
Heesel, Barbara
Bobzin, Kirsten
Kashko, Tatyana
Parkot, Daniel
Bagcivan, Nazlim
[Contribution to a conference proceedings, Journal Article]
Effect of the Substrate Geometry on Plasma Synthesis of DLC Coatings
In: Plasma processes and polymers, 6.2009 (6/7), 425-S428, 2009
[DOI: 10.1002/ppap.200931010]
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
Yilmaz, Koray
[Journal Article]
Effect of heat treatment on the microstructure and mechanical properties of Fe-based amorphous coatings
In: Journal of alloys and compounds : JAL, 480 (2), 422-427, 2009
[DOI: 10.1016/j.jallcom.2009.02.107]
Fu, Bin-you
He, Ding-yong
Zhao, Lidong
[Journal Article]
Microstructure characterisation and wear properties of arc sprayed NiB containing amorphous coatings
In: Surface engineering, 25 (4), 326-332, 2009
[DOI: 10.1179/026708409X364966]
Fu, Bin-you
He, Ding-Yong
Zhao, Lidong
Li, X. Y.
[Journal Article]
Microstructure and properties of arc sprayed coatings containing Fe based amorphous phase and nanocrystallites
In: Surface engineering, 25 (4), 333-337, 2009
[DOI: 10.1179/026708409X396060]
Fu, Bin-You
He, Ding-Yong
Zhao, Lidong
Jiang, J. M.
Li, X.Y.
[Contribution to a conference proceedings, Journal Article]
Arc Ion Plating Process Monitoring by Optical Emission Spectroscopy Exemplified for Chromium Containing Coatings
In: Plasma processes and polymers, 6.2009 (6/7), S357-S361, 2009
[DOI: 10.1002/ppap.200930806]
Bobzin, Kirsten
Bagcivan, Kirsten
Immich, Philipp
Theiß, Sebastian
[Journal Article]
Investigation of Properties and Wear Behavior of HVOF Sprayed TiC-Strengthened Fe Coatings
In: Journal of thermal spray technology : JTST, 18 (4), 672-677, 2009
[DOI: 10.1007/s11666-009-9384-4]
Bobzin, Kirsten
Schläfer, Thomas
Richardt, Katharina Rebecca Maria
Warda, Thomas
Reisel, Guido
[Journal Article]
Modeling and Simulation of Microstructure Formation for Porosity Prediction in Thermal Barrier Coatings Under Air Plasma Spraying Condition
In: Journal of thermal spray technology : JTST, 18 (5), 975-980, 2009
[DOI: 10.1007/s11666-009-9340-3]
Bobzin, Kirsten
Bagcivan, Nazlim
Parkot, Daniel
Schäfer, Marcel Pascal
Petkovic, Ivica
[Contribution to a conference proceedings, Journal Article]
Lubricated PVD CrAlN and WC/C coatings for automotive applications
In: Surface & coatings technology, 204 (6/7), 1097-1101, 2009
[DOI: 10.1016/j.surfcoat.2009.07.045]
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
Yilmaz, Koray
Höhn, Bernd-Robert
Michaelis, Klaus
Hochmann, Michael
[Journal Article]
Development of NiZn-ferrite coatings for electromagnetic applications
In: Thermal spray bulletin, 2 (2), 126-132, 2009
Talaka, Tatiana
Ilyuschencko, Alexander
Weil, Carsten
Linden, Ismo
McCartney, Graham
Zhang, Deen
Yellup, John Y.
Brühl, Markus
Bobzin, Kirsten
[Journal Article]
Detektion von Verunreinigungen beim bleifreien Wellen- und Selektivlöten und deren Auswirkungen auf die Lötstelle
In: Schweissen und Schneiden, 61 (7), 358-368, 2009
Bach, Friedrich-Wilhelm
Möhwald, Kai
Schaup, Jörg
Holländer, Ulrich
Herzog, Thomas
Wohlrabe, Heinz
Wielage, Bernhard
Lampke, Thomas
Weber-Nester, Daisy
Bobzin, Kirsten
[Journal Article]
PVD Beschichtung von Polyetheretherketon (PEEK) zur Verschleiß- und Reibungsminimierung im Kontakt Käfig-Führungsbord eines Spindellagers
In: Tribologie und Schmierungstechnik, 56, 11-15, 2009
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
[Contribution to a conference proceedings, Journal Article]
Properties of (Ti,Al,Si)N coatings for high demanding metal cutting applications deposited by HPPMS in an industrial coating unit
In: Plasma processes and polymers, 6.2009 (6/7), S124-128, 2009
[DOI: 10.1002/ppap.200930408]
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Bolz, Stephan Frédéric
Fuß, Hans-Gerd
Cremer, Rainer
[Journal Article]
Preparation of barium hexaferrite coatings using atmospheric plasma spraying
In: Journal of the European Ceramic Society, 29 (11), 2333-2341, 2009
[DOI: 10.1016/j.jeurceramsoc.2009.01.028]
Lisjak, Darja
Bobzin, Kirsten
Richardt, Katharina Rebecca Maria
Bégard, Marion
Bolelli, Giovanni
Lusvarghi, Luca
Hujanen, Arto
Lintunen, Pertti
Pasquale, Massimo
Olivetti, Elena
Drofenik, Miha
Schläfer, Thomas
[Journal Article]
Wiederaufarbeitung von Motorzylinderbohrungen durch Spritzreparatur unter Anwendung des PTWA-Verfahrens (Plasma Transferred Wire Arc)
In: Thermal spray bulletin, 2 (1), 26-31, 2009
Bobzin, Kirsten
Schläfer, Thomas
Beardsley, Brad
Gerke, Dan
Sharp, Bob
Blume, Fritz
Silk, Mark
Schramm, Leander
Schwenk, Alexander
Lindon, Spencer
[Journal Article]
Entwicklung von eisenbasierten Spritzzusatzwerkstoffen und deren Verarbeitung durch Lichtbogenspritzen
In: Thermal spray bulletin, 2 (1), 58-63, 2009
Bobzin, Kirsten
Zhao, Lidong
Schläfer, Thomas
Kutschmann, Pia
[Journal Article]
Eigenschaftsoptimierung eines niedriglegierten Stahls mittels PVD- (Physical Vapour Deposition) Technologie
In: Jahrbuch Oberflächentechnik, 65, 103-108, 2009
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
Weiß, Raphael
[Journal Article]
Investigations on nanolaminated TiZrN/CrN as a tribological PVD hard coating for incremental sheet forming tools
In: Advanced engineering materials, 11 (8), 674-679, 2009
[DOI: 10.1002/adem.200900088]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Warnke, Carsten
[Journal Article]
Thermal investigation of Al2O3 thin films for application in cutting operations
In: Advanced engineering materials, 11 (7), 590-594, 2009
[DOI: 10.1002/adem.200800421]
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Ewering, Mara Therese
[Contribution to a conference proceedings, Journal Article]
High power pulsed magnetron sputtering: fundamentals and applications
In: Journal of alloys and compounds : JAL, 483.2009 (1/2), 530-534, 2009
[DOI: 10.1016/j.jallcom.2008.08.104]
Alami, Jones
Bolz, Stephan Frédéric
Sarakinos, Kostas
[Journal Article]
Thermal spraying of Co,Ti-substituted Ba-hexaferrite coatings for electromagnetic wave absorption applications
In: Surface & coatings technology, 203 (20/21), 3312-3319, 2009
[DOI: 10.1016/j.surfcoat.2009.04.007]
Bégard, Marion
Bobzin, Kirsten
Bolelli, Giovanni
Hujanen, Arto
Lintunen, Pertti
Lisjak, Darja
Gyergyek, Sašo
Lusvarghi, Luca
Pasquale, Massimo
Richardt, Katharina Rebecca Maria
Schläfer, Thomas
Varis, Tommi
[Journal Article]
Hybridprozessentwicklung zur Plasmasynthese temperaturbeständiger Kohlenstoffschichten
In: WING, 2009, 2009
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Yilmaz, Koray
[Journal Article]
Advancement of a nanolaminated TiHfN/CrN PVD tool coating by a nano-structured CrN top layer in interaction with a biodegradable lubricant for green metal forming
In: Surface & coatings technology, 203 (20/21), 3184-3188, 2009
[DOI: 10.1016/j.surfcoat.2009.03.053]
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Warnke, Carsten
Klocke, Fritz
Zeppenfeld, Christoph
Mattfeld, Patrick
[Journal Article]
Advantages of nanocomposite coatings deposited by high power pulse magnetron sputtering technology
In: Journal of materials processing technology, 209 (1), 165-170, 2009
[DOI: 10.1016/j.jmatprotec.2008.01.035]
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Bolz, Stephan Frédéric
Alami, Jones
Cremer, Rainer
[Journal Article]
Development of a new wear resistant coating by arc spraying of a steel-based cored wire
In: Frontiers of mechanical engineering in China, 4 (1), 7-10, 2008
[DOI: 10.1007/s11465-009-0012-2]
Zhao, Lidong
Binyou Fu
Dingyong He
Kutschmann, Pia
[Journal Article]
Untersuchung zum flussmittelfreien Löten einer AlMg3-Legierung mit Hilfe der Kaltgasbelotung
In: Thermal spray bulletin, 1 (1), 50-54, 2008
Bobzin, Kirsten
Lugscheider, Erich
Ernst, Felix Björn Gustav
Richardt, Katharina Rebecca Maria
Zhao, Lidong
[Journal Article]
Neue HPPMS-Technologie - Zerspanwerkzeuge hochpulsig beschichten
In: Journal für Oberflächentechnik : JOT, 48 (1), 34-35, 2008
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Bolz, Stephan Frédéric
[Journal Article]
HyDraNo
In: WING : das Jahrbuch, 2007, 2008
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
[Journal Article]
NaCoLab
In: WING : das Jahrbuch, 2007, 2008
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Schläfer, Thomas
Richardt, Katharina Rebecca Maria
[Journal Article]
Hybridprozessentwicklung zur Plasmasynthese temperaturbeständiger Kohlenstoffschichten
In: WING, 2008, 2008
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Yilmaz, Koray
[Journal Article]
PVD - Eine Erfolgsgeschichte mit Zukunft
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 39 (1), 5-12, 2008
[DOI: 10.1002/mawe.200700252]
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Pinero, Carmen
Göbbels, Nico
Krämer, Anika
[Journal Article]
Zukunftsweisende Werkstoffkombinationen und Beschichtung beliebiger Konturen möglich
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 100 (1), 192-193, 2008
Bobzin, Kirsten
[Journal Article]
Thermisch gespritzte titankarbidverstärkte Eisenbasisschichten als Alternative zu konventionellen karbidischen Werkstoffen
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 39 (1), 13-17, 2008
[DOI: 10.1002/mawe.200700235]
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Richardt, Katharina Rebecca Maria
Warda, Thomas
Reisel, Guido
[Journal Article]
A look at the development of magnesium-based filler metals
In: Welding journal, 87 (3), 38-40, 2008
Bobzin, Kirsten
Lugscheider, Erich
Ernst, Felix Björn Gustav
Schlegel, Arne
Rösing, Jürgen
Jäger, Doris
[Journal Article]
Developing PVD zirconium-oxide coatings for use of thixoforming of steel
In: International journal of microstructure and materials properties : IJMMP, 3 (2/3), 267-270, 2008
[DOI: 10.1504/IJMMP.2008.018733]
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Immich, Philipp
[Journal Article]
Mikrostruktur und Eigenschaften lichtbogengespritzter Schichten auf Eisenbasis
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 39 (12), 867-870, 2008
[DOI: 10.1002/mawe.200800393]
Bobzin, Kirsten
Schläfer, Thomas
Richardt, Katharina Rebecca Maria
Zhao, Lidong
Kutschmann, Pia
[Journal Article]
Coating bores of light metal engine blocks with a nanocomposite material using the plasma transferred wire arc thermal spray process
In: Journal of thermal spray technology : JTST, 17 (3), 344-351, 2008
[DOI: 10.1007/s11666-008-9188-y]
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Zwick, Jochen Bernt
Schläfer, Thomas
Cook, David
Nassenstein, Klaus
Schwenk, Alexander
Schreiber, Frank
Wenz, Thomas
Flores, Gerhard
Hahn, Mareike
[Contribution to a conference proceedings, Journal Article]
Solders development and application process for a micro chip-camera
In: Microsystem technologies, 14.2008 (12), 1887-1894, 2008
[DOI: 10.1007/s00542-008-0613-4]
Bobzin, Kirsten
Lugscheider, Erich
Ernst, Felix Björn Gustav
Nickel, Reimo
Bagcivan, Nazlim
Parkot, Daniel
Schlegel, Arne
Ferrara, Stefania
Kashko, Tatyana
Leick, Noémi
[Journal Article]
Untersuchung des Benetzungsverhaltens von Schmierstoffen auf PVD-beschichteten Oberflächen und dessen Einfluss auf tribologische Eigenschaften
In: Tribologie und Schmierungstechnik, 55 (1), 5-9, 2008
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Yilmaz, Koray
[Journal Article]
Untersuchung des Einflusses unterschiedlicher Karbidbildner auf das tribologische Verhalten mittels reaktivem Magnetron-Sputter-Ion-Plating MSIP abgeschiedener Nanocomposite nc-MeC/a-C:H Beschichtungen
In: Tribologie und Schmierungstechnik, 55 (2), 5-10, 2008
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Göbbels, Nico
[Journal Article]
Anwendungen von Modellierung und Simulation zur Vorhersage der Spritzpartikel-Morphologie unter APS-Prozessbedingungen
In: Thermal spray bulletin, 1 (2), 114-118, 2008
Bobzin, Kirsten
Bagcivan, Nazlim
Parkot, Daniel
Petkovic, Ivica
[Contribution to a conference proceedings, Journal Article]
Thermal spraying of cylinder bores with the plasma transferred wire arc process
In: Surface & coatings technology, 202 (18), 4438-4443, 2008
[DOI: 10.1016/j.surfcoat.2008.04.023]
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Richardt, Katharina Rebecca Maria
Schläfer, Thomas
Verpoort, Clemens
Flores, Gerhard
[Journal Article]
Qualitätssicherung durch On-Line Prozessdiagnostik
In: Schweissen und Schneiden, 60 (2), 84-87, 2008
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Zwick, Jochen Bernt
Richardt, Katharina Rebecca Maria
Landes, Klaus
Zierhut, Jochen
[Journal Article]
Vorteile superharter Nanocomposite Beschichtungen für Zerspanwerkzeuge, abgeschieden mittels High Power Pulse Magnetron Sputtering
In: Jahrbuch Oberflächentechnik, 64, 81-88, 2008
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Bolz, Stephan Frédéric
[Journal Article]
Hydrano - Leistungssteigerung hydraulischer Verdrängereinheiten durch Nanocomposites
In: WING, 2008, 2008
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
[Journal Article]
Flux-free brazing of Mg-containing aluminium alloys by means of cold spraying
In: Frontiers of mechanical engineering in China, 3 (4), 355-359, 2008
[DOI: 10.1007/s11465-008-0055-9]
Bobzin, Kirsten
Zhao, Lidong
Ernst, Felix Björn Gustav
Richardt, Katharina Rebecca Maria
[Journal Article]
Die Oberfläche macht den Unterschied : der systemische Lösungsansatz in der industriellen Plasma-Oberflächentechnik
In: Intelligenter produzieren, 2008 (4), 10-12, 2008
Bobzin, Kirsten
Bagcivan, Nazlim
[Journal Article]
Development of oxide dispersion strengthened MCrAlY coatings
In: Journal of thermal spray technology : JTST, 17 (5/6), 853-857, 2008
[DOI: 10.1007/s11666-008-9244-7]
Bobzin, Kirsten
Schläfer, Thomas
Richardt, Katharina Rebecca Maria
Brühl, Markus
[Journal Article]
Verschleißschutz durch thermisches Spritzen : Stand und Perspektiven
In: Stahl, 2008 (3), 28-30, 2008
Bobzin, Kirsten
Schläfer, Thomas
Richardt, Katharina Rebecca Maria
Kutschmann, Pia
[Journal Article]
Tailor-made coatings for turbine applications using the Triplex Pro 200
In: Journal of thermal spray technology : JTST, 17 (5/6), 612-616, 2008
[DOI: 10.1007/s11666-008-9236-7]
Richardt, Katharina Rebecca Maria
Bobzin, Kirsten
Sporer, Dieter
Schläfer, Thomas
Fiala, Petr
[Contribution to a conference proceedings, Journal Article]
Mechanical properties and oxidation behaviour of (Al,Cr)N and (Al,Cr,Si)N coatings for cutting tools deposited by HPPMS
In: Thin solid films, 517 (3), 1251-1256, 2008
[DOI: 10.1016/j.tsf.2008.06.050]
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Bolz, Stephan Frédéric
Cremer, Rainer
Leyendecker, Thorsten
[Journal Article]
An extremely successful ITSC 2008
In: Thermal spray bulletin, 1 (2), 90-92, 2008
Bobzin, Kirsten
Schläfer, Thomas
Richardt, Katharina Rebecca Maria
Brühl, Markus
[Journal Article]
Titankarbidverstärkte Eisenbasiswerkstoffe : eine kostengünstige Lösung für Verschleißschutzanwendungen
In: Thermal spray bulletin, 1 (2), 120-126, 2008
Bobzin, Kirsten
Schläfer, Thomas
Richardt, Katharina Rebecca Maria
Warda, Thomas
Reisel, Guido
[Contribution to a book, Contribution to a conference proceedings, Journal Article]
Deposition of oxides as tool protection for large thixoforming dies by using the pulsed MSIP-PVD process
In: Diffusion and defect data - solid state data : Pt. B. Solid state phenomena, 141/143, 249-254, 2008
[DOI: 10.4028/3-908451-59-0.249]
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
[Journal Article]
Der Exzellenzcluster Integrative Produktionstechnik für Hochlohnländer der RWTH Aachen University : Herstellung hybrider Metall-Kunststoffbauteile durch moderne Fügeverfahren
In: Joining plastics = Fügen von Kunststoffen, 2 (3), 210-216, 2008
Bobzin, Kirsten
Theiß, Sebastian
Poprawe, Reinhart
Rösner, Andreas
Haberstroh, Edmund
Flock, Dustin
Reisgen, Uwe
Wagner, Nikolaus
[Journal Article]
Thermisches Spritzen : Potentiale, Entwicklungen, Märkte
In: Thermal spray bulletin, 1 (1), 30-36, 2008
Wielage, Bernhard
Rupprecht, Christian
Brühl, Markus
Richardt, Katharina Rebecca Maria
Ernst, Felix Björn Gustav
Bobzin, Kirsten
[Journal Article]
Auftraggelötete Verschleißschutzsysteme für Titanlegierungen
In: Schweissen und Schneiden, 60 (10), 566-570, 2008
Kopp, Nils
Schlegel, Arne
Ernst, Felix Björn Gustav
Bobzin, Kirsten
[Journal Article]
Microstructure based model for permeability predictions of open-cell metallic foams via homogenization
In: Materials science & engineering / A, Structural materials: properties, microstructure and processing, 472 (1/2), 214-226, 2008
[DOI: 10.1016/j.msea.2007.03.046]
Laschet, Gottfried
Kashko, Tatyana
Angel, Stefanie
Scheele, Josef
Nickel, Reimo
Bobzin, Kirsten
Bleck, Wolfgang
[Contribution to a conference proceedings, Journal Article]
High-temperature brazing for reliable tungsten-CFC joints
In: Physica scripta, T128, 175-181, 2007
[DOI: 10.1088/0031-8949/2007/T128/034]
Koppitz, Th.
Pintsuk, G.
Reisgen, Uwe
Remmel, Josef
Hirai, T.
Sievering, R.
Rojas Yoris, Yelena
Casalegno, V.
[Journal Article]
Hydroxylapatite coatings by microplasma spraying
In: Wuji-cailiao-xuebao : jikan = Journal of inorganic materials, 22 (4), 754-758, 2007
[DOI: 10.3724/SP.J.1077.2007.00754]
He, Ding-Yong
Sun, Xu-Feng
Zhao, Lidong
[Contribution to a conference proceedings, Journal Article]
Wear behavior of Cr1-xAlxNPVD-coatings in dry running conditions
In: Wear, 263 (7/12), 1274-1280, 2007
[DOI: 10.1016/j.wear.2007.01.118]
Bobzin, Kirsten
Lugscheider, Erich
Nickel, R.
Bagcivan, Nazlim
Krämer, A.
[Journal Article]
Microstructure dependency of the material properties: Simulation approaches and calculation methods for non-homogeneous materials
In: Steel research international, 78 (10/11), 804-811, 2007
Bobzin, Kirsten
Nickel, Reimo
Parkot, Daniel
Kashko, Tatyana
[Journal Article]
C-Schichten
In: WING, 2006, 2007
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
Yilmaz, Koray
[Journal Article]
Beschichtungsanlage für neue Werkstoffkombinationen : IOT mit Beschichtungsanlage der neuesten Generation
In: Werkstoffe in der Fertigung : die Fachzeitschrift für technische Führungskräfte, 2007 (6), 2007
Bobzin, Kirsten
[Journal Article]
Beschichtungsanlage für neue Werkstoffkombinationen : IOT mit Beschichtungsanlage der neuesten Generation
In: Aluminium : international journal for industry, research and application, 83, 81-81, 2007
Bobzin, Kirsten
[Journal Article]
Fügen mittels Kaltgasspritzen
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 98 (11), 2804-2805, 2007
Bobzin, Kirsten
[Journal Article]
Beschichtungsanlage für neue Werkstoffkombinationen : IOT mit Beschichtungsanlage der neuesten Generation
In: Journal für Oberflächentechnik : JOT, 6 (12), 2007
Bobzin, Kirsten
[Journal Article]
Entwicklung und Charakterisierung einer Nanocomposite nc-ZrC/a-C:H Beschichtung für den Einsatz in hydraulischen Verdrängereinheiten
In: Tribologie und Schmierungstechnik, 54 (4), 5-11, 2007
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Göbbels, Nico
[Journal Article]
Verschleißschutz für Titanbauteile
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 38 (2), 160-163, 2007
[DOI: 10.1002/mawe.200600106]
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Rösing, Jürgen
Rojas Yoris, Yelena
[Journal Article]
Hochtemperaturlöten als Reparaturverfahren zur Erweiterung der Lebensdauer einkristalliner Turbinenkomponenten
In: Schweissen und Schneiden, 59 (5), 249-252, 2007
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Rösing, Jürgen
Schlegel, Arne
Rojas Yoris, Yelena
[Journal Article]
Auftraglöten zum Verschleißschutz von Titanwerkstoffen
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 38 (7), 533-537, 2007
[DOI: 10.1002/mawe.200700164]
Bobzin, Kirsten
Ernst, F.
Rösing, J.
Rojas, Y.
[Journal Article]
Kaltgasspritzen von Al-basierten Lotwerkstoffen zum Löten von Aluminium und Aluminiumlegierungen
In: Info-Service / Fachgesellschaft Löten, 16, 16-18, 2007
Bobzin, Kirsten
Zhao, Lidong
Kutschmann, Pia
[Journal Article]
Investigation of particle flattening behaviour and bonding mechanisms of APS sprayed coatings on magnesium alloys
In: Surface & coatings technology, 201 (14), 6290-6296, 2007
[DOI: 10.1016/j.surfcoat.2006.11.034]
Bobzin, Kirsten
Lugscheider, Erich
Zwick, Jochen Bernt
Zhao, Lidong
Parco, Maria
[Journal Article]
Ökonomische und umweltverträgliche Umformtechnologien durch hochspezialisierte, funktionelle PVD-Werkzeugbeschichtungen
In: Jahrbuch Oberflächentechnik, 63, 64-70, 2007
Bobzin, Kirsten
Nickel, Reimo
Immich, Philipp
Pinero, Carmen
Warnke, Carsten
[Journal Article]
PVD-Coatings in injection molding machines for processing optical polymers
In: Plasma processes and polymers, 4 (Suppl. 1), S144-S149, 2007
[DOI: 10.1002/ppap.200730507]
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Manz, Florian
[Journal Article]
Determination of multi parametical transversely isotropic coating properties based on simulation of nanoindentation
In: International journal of surface science and engineering, 1 (2/3), 293-307, 2007
[DOI: 10.1504/IJSURFSE.2007.015030]
Bobzin, Kirsten
Nickel, Reimo
Parkot, Daniel
Hurevich, Vitalii
Göbbels, Nico
[Contribution to a book, Contribution to a conference proceedings, Journal Article]
Application of thermal barrier coatings on open porous metallics foams
In: Plasma processes and polymers, 4.2007 (Suppl.1), S547-S550, 2007
[DOI: 10.1002/ppap.200731403]
Bobzin, Kirsten
Lugscheider, Erich
Nickel, Reimo
Bagcivan, Nazlim
[Contribution to a book, Contribution to a conference proceedings, Journal Article]
Pulsed nanocomposite TiAlN coatings on complex shaped tools for high performance cutting operations
In: Plasma processes and polymers, 4.2007 (Suppl.1), S673-S676, 2007
[DOI: 10.1002/ppap.200731703]
Bobzin, Kirsten
Lugscheider, Erich
Nickel, Reimo
Immich, Philipp
Bolz, Stephan Frédéric
Klocke, Fritz
[Journal Article]
Analyse von Partikeleigenschaften beim Thermischen Spritzen von Mikropulvern
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 38 (2), 149-154, 2007
[DOI: 10.1002/mawe.200600109]
Bobzin, Kirsten
Lugscheider, Erich
Ernst, Felix Björn Gustav
Zwick, Jochen Bernt
Matthäus, Götz
[Journal Article]
Modeling and simulation in the production process control and material property calculation of complex structured EB-PVD TBCs
In: Computational materials science, 39 (3), 600-610, 2007
[DOI: 10.1016/j.commatsci.2006.08.011]
Bobzin, Kirsten
Lugscheider, Erich
Nickel, Reimo
[Journal Article]
Beschichtung von Zylinderlaufflächen moderner PKW-Motoren mit niedriglegierten Stählen und einem nanokristallinen Kompositwerkstoff
In: Tribologie und Schmierungstechnik, 54 (2), 11-16, 2007
Bobzin, Kirsten
Lugscheider, Erich
Ernst, Felix Björn Gustav
Zwick, Jochen Bernt
Schläfer, Thomas
[Journal Article]
Study on cold spraying of Al-based brazing alloys
In: Journal of thermal spray technology : JTST, 13 (2), 29-36, 2007
Zhao, Lidong
Zwick, Jochen Bernt
Ernst, Felix Björn Gustav
Bobzin, Kirsten
Lugscheider, Erich
[Journal Article]
Numerical studies of the application of shock tube technology for cold gas dynamic spray process
In: Journal of thermal spray technology : JTST, 16 (5/6), 729-735, 2007
[DOI: 10.1007/s11666-007-9123-7]
Nickel, Reimo
Bobzin, Kirsten
Lugscheider, Erich
Parkot, Daniel
Varava, Waldemar
Olivier, Herbert
Luo, Xisheng
[Journal Article]
Open porous metallic foams with thermal barrier coating and cooling hole array for high temperature turbine applications
In: High temperature material processes, 11 (3), 321-343, 2007
[DOI: 10.1615/HighTempMatProc.v11.i3.20]
Angel, Stefanie
Ratte, Evelin
Bleck, Wolfgang
Bobzin, Kirsten
Lugscheider, Erich
Nickel, R.
Richardt, Katharina Rebecca Maria
Bagcivan, Nazlim
Walther, K.
Kreutz, E. W.
Kelbassa, Ingomar
Poprawe, Reinhart
[Journal Article]
PVD-Beschichtungen für trockenlaufende Hybridwälzlager
In: Vakuum in Forschung und Praxis : VIP, 19 (2), 6-12, 2007
[DOI: 10.1002/vipr.200700313]
Gold, Peter Werner
Loos, Jörg
Plogmann, Michael
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Krämer, Anika
[Contribution to a conference proceedings, Journal Article]
Grain size evaluation of pulsed TiAlN nanocomposite coatings for cutting tools
In: Thin Solid Films, 515 (3), 3681-3684, 2006
[DOI: 10.1016/j.tsf.2006.11.002]
Bobzin, Kirsten
Lugscheider, E.
Maes, M.
Immich, P.
Bolz, S. (Corresponding author)
[Journal Article]
Wirtschaftliche Kaltmassivumformung - Neue Werkzeugbeschichtungen machen Verzicht auf Bonderbehandlung möglich
In: Industrie-Anzeiger, 34/35, 43-43, 2006
Bobzin, Kirsten
Klocke, Fritz
Zeppenfeld, Christoph
Maßmann, Thomas Christoph
Maes, Michael
Pinero, Carmen
Raedt, Hans-Willi
[Journal Article]
Investigation of HVOF spraying on magnesium alloys
In: Surface and coatings technology, 201 (6), 3269-3274, 2006
[DOI: 10.1016/j.surfcoat.2006.06.047]
Parco, Maria (Corresponding author)
Zhao, Lidong
Zwick, Jochen Bernt
Bobzin, Kirsten
Lugscheider, Erich
[Journal Article]
Improvement of thermally sprayed abradable coating by microstructure control
In: Surface & coatings technology, 201 (6), 2303-2312, 2006
[DOI: 10.1016/j.surfcoat.2006.03.047]
Faraoun, H. I.
Grosdidier, T.
Seichepine, J.-L.
Goran, D.
Aourag, H.
Coddet, C.
Zwick, Jochen Bernt
Hopkins, Noel
[Journal Article]
Alternative methods for determination of composition and porosity in abradable materials
In: Materials characterization, 57 (1), 17-29, 2006
[DOI: 10.1016/j.matchar.2005.12.004]
Matejicek, Jiri
Kolman, Blahoslav
Dubsky, Jiri
Neufuss, Karel
Hopkins, Noel
Zwick, Jochen Bernt
[Contribution to a conference proceedings, Journal Article]
Modelling route for abradable coatings
In: Surface & coatings technology, 200 (22/23), 6578-6582, 2006
[DOI: 10.1016/j.surfcoat.2005.11.105]
Faraoun, H. I.
Seichepine, J. L.
Coddet, C.
Aourag, H.
Zwick, Jochen Bernt
Hopkins, Noel
Sporer, Dieter
Hertter, M.
[Journal Article]
High kinetic process developments in thermal spray technology
In: Journal of thermal spray technology : JTST, 15 (2), 155-156, 2006
[DOI: 10.1361/105996306X108246]
Lugscheider, Erich
[Contribution to a book, Journal Article]
Thermal spraying developments
In: Advanced engineering materials, 8 (7), 595-596, 2006
Berndt, C.
Bobzin, Kirsten
Coddet, C.
Fauchais, P.
Lugscheider, Erich
Möhwald, K.
Singheiser, L.
Vardelle, A.
[Journal Article]
C-Schichten
In: WING : das Jahrbuch ; Projekte, Events und Ergebnisse / Projektträger Jülich, Forschungszentrum Jülich GmbH, 2006
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Yilmaz, Koray
[Journal Article]
HyDraNo - Leistungsteigerung in hydraulischen Verdrängereinheiten durch Nanocomposites
In: WING : das Jahrbuch, 2006, 97-97, 2006
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Göbbels, Nico
[Journal Article]
NaCoLab : Nanokristalline Composit-Beschichtungen für Zylinderlaufbahnen mit nanostrukturierter Oberfläche und Verschleißvorhersage für hochbelastete Benzin- und Dieselmotoren
In: WING : das Jahrbuch, 2006, 29-29, 2006
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Zwick, Jochen Bernt
Schläfer, Thomas
[Journal Article]
Qualitätssicherung durch online Prozessdiagnostik
In: Metalloberfläche : mo, 60 (11), 44-48, 2006
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Richardt, Katharina Rebecca Maria
Zwick, Jochen Bernt
Landes, Klaus
Forster, G.
Zierhut, Jochen
[Journal Article]
Aufwendige Vorbehandlung erübrigt sich : Werkzeugbeschichtungen: Kaltmassivumformen wird Effizienter
In: Industrie-Anzeiger, 128 (35), 43-43, 2006
Klocke, Fritz
Zeppenfeld, Christoph
Maßmann, Thomas Christoph
Bobzin, Kirsten
Maes, Michael
Pinero, Carmen
Raedt, Hans-Willi
Filgertshofer, Robert
[Journal Article]
Werkzeugbeschichtung: Verlagerung bringt Vorteile
In: Werkzeug & Formenbau, 16 (4), 27-27, 2006
Klocke, Fritz
Zeppenfeld, Christoph
Maßmann, Thomas Christoph
Bobzin, Kirsten
Maes, Michael
Pinero, Carman
Raedt, Hans-Willi
Filgertshofer, Robert
[Journal Article]
Umwelt schonende und wirtschaftliche Kaltmassivumformung
In: Der Schnitt- & Stanzwerkzeugbau, 10 (4), 59-60, 2006
Bobzin, Kirsten
Maes, Michael
Pinero, Carmen
Klocke, Fritz
Zeppenfeld, Christoph
Maßmann, Thomas Christoph
Raedt, Hans-Willi
Filgertshofer, Robert
[Journal Article]
Statt der Teile die Werkzeuge beschichten : Kaltmassivumformung: Auf Bondern gänzlich verzichten
In: Produktion : Technik und Wirtschaft für die deutsche Industrie, 45 (18), 10-10, 2006
Klocke, Fritz
Zeppenfeld, Christoph
Maßmann, Thomas Christoph
Bobzin, Kirsten
Maes, Michael
Pinero, Carmen
Raedt, Hans-Willi
Filgertshofer, Robert
[Journal Article]
Umwelt schonende und wirtschaftliche Kaltmassivumformung
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 97 (6), 1526-1527, 2006
Bobzin, Kirsten
Maes, Michael
Pinero, Carmen
Klocke, Fritz
Zeppenfeld, Christoph
Maßmann, Thomas Christoph
Raedt, Hans-Willi
Filgertshofer, Robert
[Contribution to a conference proceedings, Journal Article]
The Influence of Substrate Preparation on the PVD Coating Graded Zirconium Carbide (ZrCg) and Chromium Aluminium Nitride (CrAlN)
In: Thin solid films, 2006, 2006
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
Manz, Florian
[Abstract, Contribution to a conference proceedings, Journal Article]
Deposition of HA coatings by microplasma spraying
In: Das Dental-Labor, 7 (1), 126-126, 2006
[DOI: 10.1515/BIOMAT.2006.7.1.7]
Bobzin, Kirsten
Zwick, Jochen Bernt
Zhao, Lidong
[Journal Article]
Umweltverträgliche Kaltmassivumformung - PVD-Beschichtung statt bondern
In: Journal für Oberflächentechnik : JOT, 2006 (1), 30-31, 2006
Bobzin, Kirsten
Lugscheider, Erich
Nickel, Reimo
Immich, Philipp
Pinero, Carmen
Warnke, Carsten
Klocke, F.
Maßmann, Th.
Liauw, M.
Eichholz, S.
Raedt, H.-W.
Filgertshofer, R.
[Contribution to a conference proceedings, Journal Article]
Investigation on the Thermal Behavior of Graded and Multilayered Lanthanum Zirconate as EB-PVD Thermal Barrier Coating
In: Journal of vacuum science & technology / A, Vacuum, surfaces, & films, 24 (4), 2006
Bobzin, Kirsten
Lugscheider, Erich
Bagcivan, Nazlim
[Journal Article, News]
Funktionelle Oberflächenbeschichtungen durch Plasmaspritzen
In: PlasmaNews, 2006 (1), 2006
Bobzin, Kirsten
Lugscheider, Erich
Zwick, Jochen Bernt
[Journal Article]
Eigenspannungsreduzierende Maßnahmen für flächige Lötverbindungen in der Mikrosytemtechnik
In: Schweissen und Schneiden, 58 (5), 238-246, 2006
Bach, Friedrich-Wilhelm
Holländer, Ulrich
Bobzin, Kirsten
Varava, Waldemar
Möhwald, Kai
Roxlau, Christian
Nickel, Reimo
[Journal Article]
Völlig abgelöst - PVD-Schichtsystem verhindert anhaftende Schmelze an Spritzgiessmaschinen
In: Der Plastverarbeiter : PV, 57 (8), 42-42, 2006
Bobzin, Kirsten
Bagcivan, Nazlim
Manz, Florian
[Journal Article]
PVD-Beschichtungen auf Plastifizierschnecken
In: Kunststoffe / [Deutsche Ausgabe], 96 (8), 66-68, 2006
Michaeli, Walter
Bobzin, Kirsten
Heßner, Sebastian
Neuß, Andreas
Manz, Florian
[Journal Article]
CrAlN-PVD-Niedertemperaturbeschichtung zum Verschleißschutz von Bauteilen
In: Tribologie und Schmierungstechnik, 53 (1), 2889-2898, 2006
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
[Journal Article]
Einsatz von PVD/CVD-Schichten bei Wälzlagern
In: Jahrbuch Oberflächentechnik, 62, 106-124, 2006
Bobzin, Kirsten
Maes, Michael
[Journal Article]
Production and characterization of NiAl-Ta-Cr intermetallic coatings sprayed by high velocity oxy-fuel
In: Xiyou-jinshu-cailiao-yu-gongcheng = Rare metal materials and engineering, 35 (6), 974-977, 2006
Zhao, Lidong
He, Dingyong
Bobzin, Kirsten
Lugscheider, Erich
[Contribution to a book, Contribution to a conference proceedings, Journal Article]
Application of multiscale modeling in the coating formation simulation of APS PYSZ TBCs
In: Journal of thermal spray technology : JTST, 15 (4), 537-544, 2006
[DOI: 10.1361/105996306X147063]
Lugscheider, Erich
Bobzin, Kirsten
Nickel, Reimo
[Journal Article]
Study on the influence of plasma spray processes and spray parameters on the structure and crystallinity of hydroxylapatite coatings
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 37 (6), 516-520, 2006
[DOI: 10.1002/mawe.200600029]
Zhao, Lidong
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Zwick, Jochen Bernt
Lugscheider, Erich
[Journal Article]
(Cr1-x,Alx)N ein Review über ein vielseitig einsetzbares Schichtsystem
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 37 (10), 833-841, 2006
[DOI: 10.1002/mawe.200600048]
Bobzin, Kirsten
Lugscheider, Erich
Nickel, R.
Immich, Philipp
[Journal Article]
Thermal cycling behavior of yttria stabilized zirconia and lanthanum zirconate, as graded and bilayer EB-PVD thermal barrier coatings
In: High temperature material processes, 10 (1), 103-115, 2006
[DOI: 10.1615/HighTempMatProc.v10.i1.80]
Bobzin, Kirsten
Lugscheider, Erich
Bagcivan, Nazlim
[Contribution to a book, Contribution to a conference proceedings, Journal Article]
Alumina PVD tool coatings for the use in semi solid metal forming of steel
In: Diffusion and defect data - solid state data : Pt. B. Solid state phenomena, 116/117, 704-707, 2006
[DOI: 10.4028/www.scientific.net/SSP.116-117.704]
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Immich, Philipp
[Journal Article]
Microstructure and properties of atmospheric plasma sprayed AP40 bioactive glass-ceramic coatings
In: Wuji-cailiao-xuebao : jikan = Journal of inorganic materials, 21 (3), 759-763, 2006
[DOI: 10.3724/SP.J.1077.2006.00759]
He, Ding-Yong
Zhao, Lidong
Bobzin, Kirsten
Lugscheider, Erich
[Journal Article]
New soldering processes and solder systems for hybrid microsystems : developments and applications
In: Microsystem technologies, 12 (7), 620-625, 2006
[DOI: 10.1007/s00542-006-0079-1]
Bobzin, Kirsten
Lugscheider, Erich
Zhuang, H.
Ernst, Felix Björn Gustav
Bagcivan, Nazlim
Maes, Michael
Rösing, J.
Ferrara, Stefania
Erdle, Anja
Krämer, A.
[Journal Article]
Atmospheric plasma spraying of thermal barrier coating material ZrO2-7%/Y2O3 using on-line particle monitoring
In: Advanced engineering materials, 8 (4), 268-270, 2006
[DOI: 10.1002/adem.200500272]
Zhao, Lidong
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Lugscheider, Erich
[Journal Article]
Feasibility study of brazing aluminium alloys through pre-deposition of a braze alloy by cold spray process
In: Advanced engineering materials, 8 (8), 751-753, 2006
[DOI: 10.1002/adem.200600001]
Zhao, Lidong
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Zwick, Jochen Bernt
Rösing, Jürgen
Lugscheider, Erich
[Contribution to a book, Journal Article]
Assessment of the microplasma spraying process for coating application
In: Advanced engineering materials, 8 (7), 635-639, 2006
[DOI: 10.1002/adem.200600054]
Lugscheider, Erich
Bobzin, Kirsten
Zhao, Lidong
Zwick, Jochen Bernt
[Journal Article]
Deposition of aluminium alloy Al12Si by cold spraying
In: Advanced engineering materials, 8 (4), 264-267, 2006
[DOI: 10.1002/adem.200500227]
Zhao, Lidong
Bobzin, Kirsten
He, Dingyong
Zwick, Jochen Bernt
Ernst, Felix Björn Gustav
Lugscheider, Erich
[Contribution to a conference proceedings, Journal Article]
Carbon based tool coatings as an approach for environmentally friendly metal forming processes
In: Wear, 260 (3), 287-295, 2006
[DOI: 10.1016/j.wear.2005.04.026]
Klocke, Fritz
Maßmann, Thomas Christoph
Bobzin, Kirsten
Lugscheider, Erich
Bagcivan, Nazlim
[Journal Article]
Advanced homogenization strategies in material modeling of thermally sprayed TBCs
In: Advanced engineering materials, 8 (7), 663-669, 2006
[DOI: 10.1002/adem.200600046]
Bobzin, Kirsten
Lugscheider, Erich
Nickel, Reimo
Kashko, Tatyana
[Journal Article]
Thermal cycling behaviour of lanthanum zirconate as EB-PVD thermal barrier coating
In: Advanced engineering materials, 8 (7), 653-657, 2006
[DOI: 10.1002/adem.200600055]
Bobzin, Kirsten
Lugscheider, Erich
Bagcivan, Nazlim
[Journal Article]
The influence of hot isostatic pressing on plasma sprayed coatings properties
In: Surface & coatings technology, 201 (3/4), 1224-1227, 2006
[DOI: 10.1016/j.surfcoat.2006.01.046]
Abdel-Samad, Abdou
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
[Contribution to a conference proceedings, Journal Article]
Relation of hardness and oxygen flow of Al2O3 coatings deposited by reactive bipolar pulsed magnetron sputtering
In: Thin solid films, 494 (1/2), 255-262, 2006
[DOI: 10.1016/j.tsf.2005.08.162]
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Pinero, Carmen
[Journal Article]
Integrated approach for the development of advanced, coated gas turbine blades
In: Advanced engineering materials, 8 (6), 535-562, 2006
[DOI: 10.1002/adem.200500277]
Herzog, R.
Warnken, Nils
Steinbach, Ingo
Hallstedt, Bengt
Walter, C.
Müller, Jochen
Hajas, David E.
Münstermann, Ernst
Schneider, Jochen M.
Nickel, Reimo
Parkot, Daniel
Bobzin, Kirsten
Lugscheider, Erich
Bednarz, P.
Trunova, O.
Singheiser, Lorenz
[Contribution to a conference proceedings, Journal Article]
A systematic approach to material eligibility for the cold-spray process
In: Journal of thermal spray technology : JTST, 14 (1), 125-133, 2005
[DOI: 10.1361/10599630522738]
Vlcek, J.
Gimeno, L.
Huber, H.
Lugscheider, Erich
[Journal Article]
Metallographic investigations of composite structures of aluminium foam with thermally sprayed coatings
In: Praktische Metallographie = Practical metallography, 42 (1), 5-14, 2005
Maurer, Matthias Josef
Koch, Dieter
Zhao, Lidong
Lugscheider, Erich
[Contribution to a conference proceedings, Journal Article]
Superelastic (Cr,Al)N coatings for high end spindle bearings
In: Surface & coatings technology, 200.2006 (5/6), 1738-1744, 2005
[DOI: 10.1016/j.surfcoat.2005.08.043]
Brecher, Christian
Spachtholz, Guido
Bobzin, Kirsten
Lugscheider, Erich
Knotek, Otto
Maes, Michael
[Journal Article]
PVD-Beschichtungen schützen die Kontaktpartner
In: Facts - CemCon, 2005 (24), 8-9, 2005
Brecher, Christian
Bobzin, Kirsten
Maes, Michael
Gold, Peter Werner
Kuhn, Marius
Bugiel, Christoph
[Journal Article]
Hybridprozesstechnik zur Plasmasynthese temperaturbeständiger Kohlenstoffschichten
In: WING : das Jahrbuch, 2005, 2005
Bobzin, Kirsten
Lugscheider, Erich
Bagcivan, Nazlim
[Contribution to a book, Journal Article]
Innovative PVD-Beschichtungen für das Thixoforming von Stahl
In: Jahrbuch Oberflächentechnik, 61, 2005
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
[Journal Article]
Plasmalöten von Aluminium- und Magnesiumlegierungen
In: Der Praktiker, 97, 118-119, 2005
Bobzin, Kirsten
Lugscheider, Erich
Ernst, Felix Björn Gustav
Jäger, Doris
Rösing, J.
[Journal Article]
Aktuelle Entwicklungstrends in der thermischen Spritztechnik - eine Kurzübersicht
In: Schweissen und Schneiden, 57 (4), 137-140, 2005
Lugscheider, Erich
Bobzin, Kirsten
Zwick, J.
[Contribution to a conference proceedings, Journal Article]
Established protective tool coatings for difficult machining operations
In: Journal of vacuum science & technology / A, Vacuum, surfaces, & films, 24.2006.4, 2005
Bobzin, Kirsten
Maes, Michael
Pinero, Carmen
[Journal Article]
Mikroplasmaspritzen ein Verfahren für kleine Bauteile
In: Schweissen und Schneiden, 57 (10), 564-568, 2005
Bobzin, Kirsten
Lugscheider, Erich
Zwick, J.
Zhao, Lidong
[Journal Article]
(C,Al)N Beschichtungen für Hoschgeschwindigkeitsspindellager, Proceedings: GfT- 46. Tribologiefachtagung 26.-28.09.05, Göttingen Vortrag 22, Band I
In: Tribologie und Schmierungstechnik, 53 (3/06), 17-21, 2005
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
[Contribution to a conference proceedings, Journal Article]
Investigation of the stability of tetragonal PVD zirconia coatings without dopants
In: International journal of adhesion & adhesives, 27.2007 (5 : Special issue), 2005
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
Immich, Philipp
[Contribution to a conference proceedings, Journal Article]
Method of resolution to inhibit the growth of alumina in the intermetallic NiAl FG 75 alloy to increase TBC lifetime
In: Surface & coatings technology, 200.2005 (5/6), 2005
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Lackner, Kristijan
[Journal Article]
Einfluss von Silizium-Dotierungen auf das Reibverhalten von kohlenstoffbasierten PVD-Beschichtungen
In: Tribologie und Schmierungstechnik, 52 (6), 37-41, 2005
Lugscheider, Erich
Bobzin, Kirsten
Bagcivan, Nazlim
[Journal Article]
Laser drilled microholes in zirconia coated surfaces using two variants to implement the effusion cooling of first stage turbine blades
In: Advanced engineering materials, 7 (3), 145-152, 2005
[DOI: 10.1002/adem.200400148]
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
Lackner, K.
Poprawe, Reinhart
Kreutz, E. W.
Willach, J.
[Journal Article]
The effect of pulse sequence modulation and pulse energy on structural coating properties and coating composition
In: Surface & coatings technology, 200 (5/6), 1560-1565, 2005
[DOI: 10.1016/j.surfcoat.2005.08.064]
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
[Contribution to a conference proceedings, Journal Article]
Monte Carlo simulation of the PVD transport process for alloys
In: Surface & coatings technology, 200.2005 (1/4), 913-915, 2005
[DOI: 10.1016/j.surfcoat.2005.02.141]
Lugscheider, Erich
Bobzin, Kirsten
Papenfuß-Janzen, Nobert
Parkot, Daniel
[Contribution to a conference proceedings, Journal Article]
Advancement in low melting solder deposition by pulsed magnetron sputter-PVD process for microsystemtechnology
In: Surface & coatings technology, 200.2005 (1/4), 444-447, 2005
[DOI: 10.1016/j.surfcoat.2005.02.193]
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
Ferrara, Stefania
Erdle, Anja
[Journal Article]
HVOF spraying of Al 2O 3-dispersion-strengthened NiCr powders
In: Surface & coatings technology, 182 (1), 72-77, 2004
[DOI: 10.1016/S0257-8972(03)00874-0]
Zhao, Lidong
Zwick, Jochen Bernt
Lugscheider, Erich
[Journal Article]
High velocity oxy-fuel thermal spraying of a NiCoCrAlY alloy
In: Surface & coatings technology, 179 (2/3), 272-278, 2004
[DOI: 10.1016/S0257-8972(03)00818-1]
Zhao, Lidong
Parco, Maria
Lugscheider, Erich
[Journal Article]
Characterisation and optimisation of innovative solders for transient liquid phase bonding and active soldering
In: Advanced engineering materials, 6 (3), 160-163, 2004
[DOI: 10.1002/adem.200300538]
Lugscheider, Erich
Ferrara, S.
[Contribution to a conference proceedings, Journal Article]
Progress and developments in the field of materials for transient liquid phase bonding and active soldering processes
In: Microsystem technologies, 10 (3), 233-236, 2004
[DOI: 10.1007/s00542-003-0351-6]
Lugscheider, Erich
Ferrara, S.
Janssen, H.
Reimann, A.
Wildpanner, B.
[Contribution to a conference proceedings, Journal Article]
Plasma diagnostics as a tool for the modeling and simulation of sputter processes
In: Surface & coatings technology, 177-178, 597-602, 2004
[DOI: 10.1016/j.surfcoat.2003.08.066]
Lugscheider, Erich
Papenfuss-Janzen, Norbert
[Journal Article]
The new easyFoam-process and mechanical properties of foam-coating-sandwiches
In: Advanced materials, 6 (11), 893-896, 2004
[DOI: 10.1002/adem.200300523]
Maurer, M.
Zhao, Lidong
Lugscheider, Erich
[Contribution to a conference proceedings, Journal Article]
Neue PVD-Schichtkonzepte für hoch beanspruchte Werkzeuge für umweltverträgliche Fertigungsprozesse
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 35 (10/11), 851-857, 2004
[DOI: 10.1002/mawe.200400804]
Bobzin, Kirsten
Lugscheider, Erich
Piñero, C.
[Journal Article]
Influence of spray parameters on the particle in-flight properties and the properties of HVOF coating of WC-CoCr
In: Wear, 257 (1/2), 41-46, 2004
[DOI: 10.1016/j.wear.2003.07.002]
Zhao, Lidong
Maurer, Matthias Josef
Fischer, Falko
Dicks, Robert
Lugscheider, Erich
[Journal Article]
Study of HVOF spraying of WC-CoCr using on-line particle monitoring
In: Surface & coatings technology, 185 (2/3), 160-165, 2004
[DOI: 10.1016/j.surfcoat.2003.12.024]
Zhao, Lidong
Maurer, Matthias Josef
Fischer, Falko
Lugscheider, Erich
[Journal Article]
Wear behaviour of Al2O3 dispersion strengthened MCrAlY coating
In: Surface & coatings technology, 184 (2/3), 298-306, 2004
[DOI: 10.1016/j.surfcoat.2003.10.055]
Zhao, Lidong
Parco, Maria
Lugscheider, Erich
[Contribution to a conference proceedings, Journal Article]
Development of a superlattice (Ti,Hf,Cr)N coating for cold metal forming applications
In: Surface & coatings technology, 177/178.2004, 616-622, 2004
[DOI: 10.1016/S0257-8972(03)00935-6]
Lugscheider, Erich
Bobzin, Kirsten
Pinero, Carmen
Klocke, Fritz
Maßmann, Thomas Christoph
[Journal Article]
Lanthanzirkonat : ein innovatives Wärmedämmschichtmaterial
In: Vakuum in Forschung und Praxis : VIP, 16, 170-175, 2004
[DOI: 10.1002/vipr.200400229]
Lugscheider, Erich
Bobzin, Kirsten
Lackner, Kristijan
[Journal Article]
Modernste PVD-Dünnschichttechnologie erobert neue Märkte
In: Jahrbuch Oberflächentechnik, 60, 108-125, 2004
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
[Journal Article]
Herstellung eines Mikroaktors auf der Basis lasergestützter Strukturierung von PVD-abgeschiedenen Bimetallstrukturen
In: Produktion von Leiterplatten und Systemen : PLUS, 6 (5), 2004
Lugscheider, Erich
Bobzin, Kirsten
Erdle, Anja
Horn, A.
Pütz, U.
Kreutz, E. W.
Poprawa, R.
[Contribution to a conference proceedings, Journal Article]
High-performance chromium aluminium nitride PVD coatings on roller bearings
In: Surface & coatings technology, 188/189.2004, 649-654, 2004
[DOI: 10.1016/j.surfcoat.2004.07.030]
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Gold, Peter Werner
Loos, J.
Kuhn, M.
[Journal Article]
PVD-Niedertemperaturbeschichtung für Bauteile zur Integration tribologischer Funktionen in die Oberfläche
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 35 (10/11), 843-850, 2004
[DOI: 10.1002/mawe.200400803]
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
[Contribution to a conference proceedings, Journal Article]
Plasma diagnostical comparison of the MSIP process of (Ti,Al)N with pulsed and dc power supplies using energy-resolved mass spectroscopy
In: Surface & coatings technology, 188/189, 164-167, 2004
[DOI: 10.1016/j.surfcoat.2004.08.011]
Lugscheider, Erich
Bobzin, Kirsten
Papenfuß-Janzen, Norbert
Maes, Michael
Parkot, Daniel
[Contribution to a conference proceedings, Journal Article]
Active soft solder deposition by magnetron-sputter-ion-plating (MSIP)-PVD-process
In: Thin solid films, 447/448.2004, 327-331, 2004
[DOI: 10.1016/S0040-6090(03)01110-6]
Lugscheider, Erich
Bobzin, Kirsten
Erdle, Anja
[Contribution to a conference proceedings, Journal Article]
On the coating of polymers : basic investigations
In: Thin solid films, 459.2004 (1/2), 313-317, 2004
[DOI: 10.1016/j.tsf.2003.12.134]
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
Krämer, Anika
[Contribution to a book, Journal Article]
Characterization of steel thixoforming tool materials by high temperature compression tests
In: Steel research international, 75.2004 (8/9), 569-576, 2004
Kopp, Reiner
Shimahara, Hideki
Schneider, Jochen M.
Kurapov, Denis
Telle, Rainer
Münstermann, Simon
Lugscheider, Erich
Abdel-Samad, Abdou
Bobzin, Kirsten
Maes, Michael
[Journal Article]
Thermal spraying of a nitrogen alloyed austenitic steel
In: Thin solid films, 424 (2), 213-218, 2003
[DOI: 10.1016/S0040-6090(02)01047-7]
Zhao, Lidong
Maurer, Matthias Josef
Lugscheider, Erich
[Contribution to a conference proceedings, Journal Article]
Finite element simulation of a coating formation on a turbine blade during plasma spraying
In: Surface & coatings technology, 174-175, 475-481, 2003
[DOI: 10.1016/S0257-8972(03)00331-1]
Lugscheider, Erich
Nickel, R.
[Contribution to a conference proceedings, Journal Article]
First results on duplex coatings without intermediate mechanical treatment
In: Surface & coatings technology, 174-175, 671-676, 2003
[DOI: 10.1016/S0257-8972(03)00578-4]
Kamminga, J. D.
Hoy, R.
Janssen, G. C. A.
Lugscheider, Erich
Maes, M.
[Contribution to a conference proceedings, Journal Article]
Investigation of thermal spraying processes using simulation methods
In: Journal of materials processing technology, 26 (2), 217-226, 1991
[DOI: 10.1016/0924-0136(91)90135-2]
Elsing, Rainer
Knotek, Otto
Balting, U.
[Journal Article]
Oberflächen tunen - PVD/CVD-Dünnschichttechnologie
In: Metalloberfläche : mo, 57 (9), 33-37, 2003
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
[Journal Article]
Erosion- und brandrissmindernde PVD-Hartstoffschichten für Aluminium und Magnesium-Druckgießformen
In: International foundry research, 55 (3), 93-97, 2003
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
[Contribution to a conference proceedings, Journal Article]
New concepts of graded zirconium carbide coatings for components
In: Surface & coatings technology, 177/178.2004, 2003
Lugscheider, Erich
Knotek, Otto
Bobzin, Kirsten
Maes, Michael
[Contribution to a conference proceedings, Journal Article]
Low temperature deposition of CrAlN coatings for the application on machine parts
In: Surface & coatings technology, 177/178.2004, 2003
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
[Contribution to a conference proceedings, Journal Article]
Increasing AlN amount in magnetron sputtered Cr(1-x)Al(x)N PVD-coatings for high temperature applications by means of pulsed power supplies
In: Surface & coatings technology, 177/178.2004, 2003
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
[Journal Article]
Study on atmospheric plasma spraying of Al2O3 using on-line particle monitoring
In: Surface & coatings technology, 136/138 (2/3), 258-262, 2003
[DOI: 10.1016/S0257-8972(03)00201-9]
Lugscheider, Erich
Zhao, Lidong
Seemann, Klaus
Fischer, Arne
[Journal Article]
Influence of the spraying processes on the properties of 316L stainless steel coatings
In: Surface & coatings technology, 162 (1), 6-10, 2003
[DOI: 10.1016/S0257-8972(02)00560-1]
Lugscheider, Erich
Zhao, Lidong
[Journal Article]
The influence of milling parameters on the properties of the milled powders and the resultant coatings
In: Surface & coatings technology, 168 (2/3), 179-185, 2003
[DOI: 10.1016/S0257-8972(03)00202-0]
Lugscheider, Erich
Zwick, Jochen Bernt
Zhao, Lidong
[Contribution to a conference proceedings, Journal Article]
Investigations of mechanical and tribological properties of CrAlN+C thin coatings deposited on cutting tools
In: Surface & coatings technology, 174/175.2003, 681-686, 2003
[DOI: 10.1016/S0257-8972(03)00566-8]
Lugscheider, Erich
Bobzin, Kirsten
Lackner, Kristijan
[Journal Article]
Determination of mechanical properties of electron beam-physical vapor deposition-thermal barrier coatings (EB-PVD-TBCs) by means of nanoindentation and impact testing
In: Surface & coatings technology, 163/164, 75-80, 2003
[DOI: 10.1016/S0257-8972(02)00594-7]
Bouzakis, K.-D.
Lontos, A.
Michailidis, N.
Knotek, Otto
Lugscheider, Erich
Bobzin, Kirsten
Etzkorn, Achim Helmut
[Contribution to a conference proceedings, Journal Article]
Solder deposition for transient liquid phase (TLP)-bonding by MSIP-PVD-process
In: Surface & coatings technology, 174/175.2003, 704-707, 2003
[DOI: 10.1016/S0257-8972(03)00692-3]
Lugscheider, Erich
Bobzin, Kirsten
Erdle, Anja
[Journal Article]
Wettability of PVD compound materials by lubricant
In: Surface & coatings technology, 165 (1), 51-57, 2003
[DOI: 10.1016/S0257-8972(02)00724-7]
Lugscheider, Erich
Bobzin, Kirsten
[Journal Article]
In-flight reactions of metallic particles during thermal spraying
In: Advanced engineering materials, 4 (12), 922-924, 2002
[DOI: 10.1002/adem.200290005]
Zhao, Lidong
Herbst-Dederichs, C.
Lugscheider, Erich
[Contribution to a conference proceedings, Journal Article]
Surface refinement of metal foams
In: Advanced engineering materials, 4 (10), 791-797, 2002
[DOI: 10.1002/1527-2648(20021014)4:10<791::AID-ADEM791>3.0.CO;2-Q]
Maurer, Matthias Josef
Zhao, Lidong
Lugscheider, Erich
[Journal Article]
High-temperature brazing of superalloys and stainless steels with novel ductile Ni-Hf-based filler metals
In: Advanced engineering materials, 4 (3), 138-142, 2002
[DOI: 10.1002/1527-2648(200203)4:3<138::AID-ADEM138>3.0.CO;2-Y]
Lugscheider, Erich
Humm, S.
[Journal Article]
High velocity oxy-fuel spraying of a NiCoCrAlY and an intermetallic NiAl-TaCr alloy
In: Surface & coatings technology, 149 (2/3), 230-235, 2002
[DOI: 10.1016/S0257-8972(01)01444-X]
Zhao, Lidong
Lugscheider, Erich
[Contribution to a conference proceedings, Journal Article]
Process and advantage of multicomponent and multilayer PVD coatings
In: Surface & coatings technology, 59 (1/3), 14-20, 1993
[DOI: 10.1016/0257-8972(93)90048-S]
Knotek, O.
Löffler, Frank
Krämer, G.
[Contribution to a conference proceedings, Journal Article]
Ceramic cathodes for arc-physical vapour deposition : development and application
In: Surface & coatings technology, 49 (1/3), 263-267, 1991
[DOI: 10.1016/0257-8972(91)90066-6]
Knotek, Otto
Löffler, Frank
Bohmer, M.
Breidenbach, R.
Stossel, C.
[Contribution to a conference proceedings, Journal Article]
Amorphous carbon physically vapour deposited coatings
In: Surface & coatings technology, 49 (1/3), 370-373, 1991
[DOI: 10.1016/0257-8972(91)90085-B]
Knotek, Otto
Löffler, Frank
Brand, J.
Burgmer, W.
[Journal Article]
PVD-beschichtete Zerspanwerkzeuge für moderne Zerspanoperationen (Teil 1)
In: Stahl, 2002 (3), 45-47, 2002
Lugscheider, Erich
Bobzin, Kirsten
Hornig, Thomas
Colmenares, C.
[Journal Article]
PVD-beschichtete Zerspanwerkzeuge für moderne Zerspanoperationen (Teil 2)
In: Stahl, 2002 (4), 45-47, 2002
Lugscheider, Erich
Bobzin, Kirsten
Hornig, Thomas
Colmenares, C.
[Journal Article]
Übertragung tribologischer Funktionen der Schmierstoffe auf die Werkstoffoberfläche mittels PVD-Technologie
In: Tribologie und Schmierungstechnik, 49 (1), 16-20, 2002
Lugscheider, Erich
Bobzin, Kirsten
[Contribution to a book, Journal Article]
Wenn Schichten laufen wie geschmiert... : Moderne PVD-Schichten ersetzen umweltgefährdende Schmierstoff-Additive
In: RWTH-Themen : Berichte aus der Rheinisch-Westfälischen Technischen Hochschule Aachen, 2002 (1), 81-83, 2002
Beckers, Manfred
Lugscheider, Erich
Bobzin, Kirsten
Hornig, Th.
[Journal Article]
Das tribologische Verhalten von neu entwickelten PVD-Schichten für die umweltverträgliche Kaltumformung
In: Tribologie und Schmierungstechnik, 49 (6), 19-25, 2002
Lugscheider, Erich
Bobzin, Kirsten
Beckers, M.
Colmenares, C.
Klocke, F.
Raedt, H.-W.
[Contribution to a conference proceedings, Journal Article]
Energy resolved ion mass spectroscopy of (Ti,Al)N hard coatings deposited by bipolar pulsed magnetron sputtering
In: Surface & coatings technology, 174/175, 2002
Lugscheider, Erich
Bobzin, Kirsten
Papenfuß-Janzen, Norbert
Erkens, Georg
Cremer, R.
Rambadt, S.
[Journal Article]
Reactive plasma spraying of TiAl6V4 alloy
In: Wear, 253 (11/12), 1214-1218, 2002
[DOI: 10.1016/S0043-1648(02)00246-6]
Lugscheider, Erich
Zhao, Lidong
[Journal Article]
Berechnung von Wärmebehandlungsprozessen - Welche Möglichkeiten hat der Praktiker? Teil I: Temperaturfelder und verwandte Eigenschaften wie Gefüge und Härte
In: Der Wärmebehandlungsmarkt : Daten, Fakten, Angebote / Dr. Sommer Werkstofftechnik GmbH, 2002 (3), 5-8, 2002
Elsing, Rainer
[Journal Article]
Graded EB-PVD-thermal barrier coatings produced by powder evaporation
In: Advanced engineering materials, 4 (12), 919-922, 2002
[DOI: 10.1002/adem.200290004]
Lugscheider, Erich
Bobzin, Kirsten
Etzkorn, Achim Helmut
Syrokas, G.
Siry, C. W.
[Contribution to a conference proceedings, Journal Article]
Investigation of the residual stresses and mechanical properties of (Cr,Al)N arc PVD coatings used for semi-solid metal (SSM) forming dies
In: Thin solid films, 420/421, 318-323, 2002
[DOI: 10.1016/S0040-6090(02)00831-3]
Lugscheider, Erich
Bobzin, Kirsten
Hornig, Thomas
Maes, Michael
[Journal Article]
Testing and design of tool coatings with properties adapted to the use of biodegradable cutting fluids
In: CIRP annals : manufacturing technology, 50 (1), 57-60, 2001
[DOI: 10.1016/S0007-8506(07)62070-8]
Klocke, Fritz
Krieg, T.
Lugscheider, Erich
Bobzin, Kirsten
[Journal Article]
PVD-Beschichtungen lassen Kunststoffe kalt
In: Metalloberfläche : mo, 55 (10), 34-37, 2001
Lugscheider, Erich
Bobzin, Kirsten
Hornig, Thomas
Beckers, M.
[Contribution to a conference proceedings, Journal Article]
Deposition of solder for micro-joining on M.E.M.S. components by means of magnetron sputtering
In: Surface & coatings technology, 142/144, 813-816, 2001
[DOI: 10.1016/S0257-8972(01)01182-3]
Lugscheider, Erich
Bobzin, Kirsten
Lake, Michael K.
[Journal Article]
Atomistic simulation of surface evolution during PVD coating processes
In: Surface & coatings technology, 142/144, 923-927, 2001
[DOI: 10.1016/S0257-8972(01)01316-0]
Lugscheider, Erich
Hayn, G. v.
[Journal Article]
Thermal spraying of a high nitrogen duplex austenitic-ferritic steel
In: Surface & coatings technology, 141 (2/3), 208-215, 2001
[DOI: 10.1016/S0257-8972(01)01233-6]
Lugscheider, Erich
Zhao, Lidong
Fischer, A.
Reimann, A.
[Journal Article]
Systematische Entwicklung gradierter ZrC und HfC Schichten für tribologische Anwendungen am Beispiel von hydraulischen Komponenten
In: Tribologie und Schmierungstechnik, 48 (1), 2001
Lugscheider, Erich
Bobzin, Kirsten
Burckhardt, M.
Murrenhoff, Hubertus
van Bebber, David
[Journal Article]
Metall-Kohlenstoffschichten (ZrCg und HfCg) für den Einsatz in hydraulischen Komponenten
In: O + P : Fluidtechnik für den Maschinen- und Anlagenbau, 45 (5), 361-, 2001
Murrenhoff, Hubertus
van Bebber, David
Lugscheider, Erich
Bobzin, Kirsten
Burckhardt, M.
[Journal Article]
Widening the usability of yttria stabilised zirconia by advanced cooling technology
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 32 (8), 660-664, 2001
[DOI: 10.1002/1521-4052(200108)32:8<660::AID-MAWE660>3.0.CO;2-G]
Lugscheider, Erich
Bobzin, Kirsten
Etzkorn, Achim Helmut
[Journal Article]
Characteristic curves of voltage and current phase generation and properties of tungsten- and vanadium-oxides deposited by reactive d.c.-MSIP-PVD-process for self-lubricating applications
In: Surface & coatings technology, 142/144, 137-142, 2001
[DOI: 10.1016/S0257-8972(01)01318-4]
Lugscheider, Erich
Knotek, Otto
Bärwulf, Stephan
Bobzin, Kirsten
[Journal Article]
The influence on surface free energy of PVD-coatings
In: Surface & coatings technology, 142/144, 755-760, 2001
[DOI: 10.1016/S0257-8972(01)01315-9]
Lugscheider, Erich
Bobzin, Kirsten
[Journal Article]
Mechanical properties of EB-PVD-thermal barrier coatings by nanoindentation
In: Surface & coatings technology, 138 (1), 9-13, 2001
[DOI: 10.1016/S0257-8972(00)01147-6]
Lugscheider, Erich
Bobzin, Kirsten
Bärwulf, Stephan
Etzkorn, Achim Helmut
[Journal Article]
A comparative study on thermally sprayed alumina based ceramic coatings
In: Journal of materials science : JMS, 35 (12), 3127-3130, 2000
[DOI: 10.1023/A:1004824104162]
Abdel-Samad, A. A.
El-Bahloul, A. M.
Lugscheider, Erich
Rassoul, S. A.
[Contribution to a conference proceedings, Journal Article]
Erhöhung und Charakterisierung der Festigkeit von Metallschäumen für lasttragende Anwendungen durch thermisch gespritzte Verbundstrukturen
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 31 (6), 523-526, 2000
[DOI: 10.1002/1521-4052(200006)31:6<523::AID-MAWE523>3.0.CO;2-%23]
Maurer, Matthias Josef
Lugscheider, Erich
[Journal Article]
Tribological behaviour at room temperature and at 550°C of TiC-based plasma sprayed coatings in fretting gross slip conditions
In: Wear, 244 (1/2), 165-179, 2000
[DOI: 10.1016/S0043-1648(00)00455-5]
Economou, S.
de Bonte, M.
Celis, J. P.
Smith, R. W.
Lugscheider, Erich
[Journal Article]
Electron beam-physical vapor deposition - thermal barrier coatings on laser drilled surfaces for transpiration cooling
In: Surface & coatings technology, 133/134, 49-53, 2000
[DOI: 10.1016/S0257-8972(00)00872-0]
Lugscheider, Erich
Bobzin, Kirsten
Etzkorn, Achim Helmut
Horn, Alexander
Weichenhain, Ruth
Kreutz, Ernst Wolfgang
Poprawe, Reinhart
[Journal Article]
Functional metal based coatings on ceramic substrates
In: Surface & coatings technology, 132, 222-276, 2000
[DOI: 10.1016/S0257-8972(00)00868-9]
Löffler, Frank
[Journal Article]
Reactive plasma spraying of titanium
In: Advanced engineering materials, 2 (5), 281-284, 2000
[DOI: 10.1002/(SICI)1527-2648(200005)2:5<281::AID-ADEM281>3.3.CO;2-T]
Lugscheider, Erich
Zhao, Lidong
Fischer, Andreas
[Journal Article]
Benetzbarkeit von PVD-Werkstoffverbunden durch Schmierstoffe
In: Tribologie und Schmierungstechnik, 48 (2), 2000
Lugscheider, Erich
Bobzin, Kirsten
[Contribution to a conference proceedings, Journal Article]
Tool coating deposited by PVD-processes for the protection against corrosion and wear of the aluminium thixoforming-process
In: Thin solid films, 377/378, 2000
Lugscheider, Erich
Knotek, Otto
Wolff, C.
Bärwulf, Stephan
[Journal Article]
Brazing of silicon nitride with reactive filler metals
In: Science and engineering of composite materials, 7 (3), 107-112, 2000
Lugscheider, Erich
Buschke, I.
Indacochea, J. E.
Tillmann, W.
Trehan, V.
Trickey, S.
[Journal Article]
On the oxidation of Ni-23Co-17Cr-12Al-0.5Y-Alloy serving as bond coat in thermal barrier coatings
In: High temperature material processes, 4 (3), 339-350, 2000
Haugsrud, R.
Kvernes, I.
Lugscheider, Erich
[Journal Article]
PVD-Dünnschichttechnologie für maßgeschneiderte Oberflächen
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 91 (9), 2580-2585, 2000
Lugscheider, Erich
Bobzin, Kirsten
Bärwulf, Stephan
[Journal Article]
Rockwell-Härteprüfmaschinen kalibrieren
In: Materialprüfung : MP, 42, 2000
Löffler, F.
[Journal Article]
Lotlegierungen und Lötverfahren zum flussmittelfreien Löten schwer benetzbarer Werkstoffe
In: Schweissen und Schneiden, 52 (8), 454-460, 2000
Hillen, Frank
Pickart-Castillo, Darmar
Rass, I. J.
Lugscheider, Erich
[Journal Article]
Simulation of heat transfer and residual stresses in plasma spray coating
In: News of Belarusian Academy of Science / Series of physic-technical science, 2000 (1), 134-141, 2000
Kuzmenkov, A.
Kundas, S.
Gurevich, V.
Lugscheider, Erich
Eritt, U.
[Journal Article]
Computer modelling of the plasma spraying process
In: The Paton welding journal, 12, 40-51, 2000
Lugscheider, Erich
Eritt, U.
Krivtsun, I. V.
Muzhichenko, A. F.
Yu, S.
[Journal Article]
Feinbleche aus verzinktem Stahl ohne Flussmittel hartlöten
In: Der Praktiker, 52 (3), 94-96, 2000
Lugscheider, Erich
Schlimbach, K.
[Journal Article]
Durch Pulver-Plasmaauftragschweißen Verschleißverhalten von Aluminiumlegierungen verbessern
In: Der Praktiker, 52 (4), 142-146, 2000
Lugscheider, Erich
Dilthey, Ulrich
Kabatnik, Lars
Langer, G.
Schlimbach, K.
[Journal Article]
PVD hard coatings protecting the surface of thixoforming tools
In: Advanced engineering materials, 2 (1/2), 33-37, 2000
[DOI: 10.1002/(SICI)1527-2648(200002)2:1/2<33::AID-ADEM33>3.0.CO;2-J]
Lugscheider, Erich
Bobzin, Kirsten
Bärwulf, Stephan
Hornig, T.
[Journal Article]
Durch Pulver-Plasmaauftragschweißen Verschleißverhalten von Aluminiumlegierungen verbessert
In: Der Praktiker, 52 (4), 142-148, 2000
Dilthey, Ulrich
Kabatnik, Lars
Lugscheider, Erich
Schlimbach, K.
[Journal Article]
Tribological properties, phase generation and high temperature phase stability of tungsten- and vanadium-oxides deposited by reactive MSIP-PVD process for innovative lubrication applications
In: Surface & coatings technology, 133/134 (1/3), 362-368, 2000
[DOI: 10.1016/S0257-8972(00)00963-4]
Lugscheider, Erich
Knotek, Otto
Bobzin, Kirsten
Bärwulf, Stephan
[Journal Article]
Oxidation characteristics and surface energy of chromium-based hardcoatings for use in semisolid forming tools
In: Surface & coatings technology, 133/134, 540-547, 2000
Lugscheider, Erich
Bobzin, Kirsten
Bärwulf, Stephan
Hornig, T.
[Journal Article]
Möglichkeiten zur Steigerung der Oberflächenfestigkeit bei Aluminiumlegierungen mit Plasma-Pulver-Schweißverfahren
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 30 (11), 697-702, 1999
[DOI: 10.1002/(SICI)1521-4052(199911)30:11<697::AID-MAWE697>3.3.CO;2-D]
Dilthey, Ulrich
Kabatnik, Lars
Lugscheider, Erich
Schlimbach, K.
Langer, G.
[Contribution to a conference proceedings, Journal Article]
Investigation of the mechanical and structural properties of Ti-Hf-C-N are PVD coatings
In: Surface & coatings technology, 116, 239-243, 1999
[DOI: 10.1016/S0257-8972(99)00115-2]
Lugscheider, E.
Knotek, O.
Zimmermann, H.
Hellmann, S.
[Contribution to a conference proceedings, Journal Article]
Magnetron sputtered titanium nitride thin films on thermoplastic polymers
In: Surface & coatings technology, 116, 1172-1178, 1999
[DOI: 10.1016/S0257-8972(99)00157-7]
Lugscheider, E.
Bärwulf, S.
Riester, M.
Hilgers, H.
[Journal Article]
Effect of thermal aging on the erosion resistance of air plasma sprayes zirconia thermal barrier coating
In: Surface & coatings technology, 113 (3), 278-285, 1999
[DOI: 10.1016/S0257-8972(99)00002-X]
Lugscheider, Erich
Remer, P.
Janos, B. Z.
[Contribution to a conference proceedings, Journal Article]
Superhard PVD coatings in the B-N-C triangle
In: International journal of refractory and hard metals : R & HM, 17 (1/3), 157-162, 1999
[DOI: 10.1016/S0263-4368(98)00066-3]
Lugscheider, Erich
Knotek, Otto
Syri, C. W.
[Journal Article]
Simulation of the film growth and film-substrate mixing during the sputter deposition process
In: Surface & coatings technology, 116/119, 568-572, 1999
Lugscheider, Erich
Hayn, G. v.
[Journal Article]
Morphology of sputtered titanium nitride thin films on thermoplastic polymers
In: Surface & coatings technology, 116/119, 1001-1005, 1999
Lugscheider, Erich
Riester, M.
Bärwulf, Stephan
Hilgers, H.
[Journal Article]
PVD-hard coated reamers in lubricant - free cutting
In: Surface & coatings technology, 112, 146-151, 1999
[DOI: 10.1016/S0257-8972(98)00775-0]
Lugscheider, Erich
Knotek, Otto
Barimani, Cyrus
Leyendecker, T.
Lemmer, O.
Wenke, R.
Wenke, R.
[Journal Article]
Properties of tungsten and vanadium oxides deposited by MSIP-PVD process for self-lubricating applications
In: Surface & coatings technology, 120/121, 458-464, 1999
Lugscheider, Erich
Barimani, Cyrus
Bärwulf, Stephan
[Journal Article]
Magnetron sputtered titanium nitride thin films on thermoplastic polymeres
In: Surface & coatings technology, 116/119, 1172-1178, 1999
Lugscheider, Erich
Bärwulf, Stephan
Riester, M.
Hilgers, H.
[Journal Article]
Entwicklung einer Technologie zum flußmittelfreien Löten verzinkten Stahls
In: Schweissen und Schneiden, 52 (4), 1999
Lugscheider, Erich
Schlimbach, K.
[Journal Article]
Optical emission spectroscopy studies of titanium nitride sputtering on thermoplastic polymers
In: Surface & coatings technology, 116/119, 981-985, 1999
[DOI: 10.1016/S0257-8972(99)00214-5]
Lugscheider, Erich
Neuhäuser, M.
Bärwulf, Stephan
Hilgers, H.
Riester, M.
[Journal Article]
Composition of the interface region of sputtered titanium nitride thin films on thermoplastic polymers
In: Surface & coatings technology, 116/119, 1179-1182, 1999
Lugscheider, Erich
Riester, M.
Bärwulf, Stephan
Hilgers, H.
[Journal Article]
Investigation of the mechanical and structural properties of Ti-Hf-C-N arc PVD coatings
In: Surface & coatings technology, 116/119, 1999
Lugscheider, Erich
Knotek, Otto
Zimmermann, H.
Hellmann, S.
[Journal Article]
Synthetische Ester und PVD-beschichtete Bauteile als Elemente umweltverträglicher Tribosysteme
In: Tribologie und Schmierungstechnik, 46 (10), 1999
Murrenhoff, Hubertus
Remmelmann, Andreas
Lugscheider, Erich
Bobzin, Kirsten
[Journal Article]
Investigations of the mechanical and structural properties of Ti-Hf-C-N Arc PVD coatings
In: Surface & coatings technology, 116/119, 239-243, 1999
Lugscheider, Erich
Knotek, Otto
Zimmermann, H.
Hellmann, S.
[Journal Article]
Herstellung und Eigenschaftsbestimmung dünner Auftraglotschichten
In: Schweissen und Schneiden, 51 (5), 1999
Lugscheider, Erich
[Journal Article]
Structure and properties of PVD-coatings by means of impact tester
In: Surface & coatings technology, 116/119, 141-146, 1999
Lugscheider, Erich
Knotek, Otto
Wolff, C.
Bärwulf, Stephan
[Journal Article]
The effect of PVD layer constitution on surface free energy
In: Thin solid films, 355/356 (1), 367-373, 1999
[DOI: 10.1016/S0040-6090(99)00543-X]
Lugscheider, Erich
Bobzin, Kirsten
Möller, M.
[Contribution to a conference proceedings, Journal Article]
Parameter studies on high-velocity oxy-fuel spraying of MCrAlY coatings
In: Surface & coatings technology, 108 (1/3), 16-23, 1998
[DOI: 10.1016/S0257-8972(98)00630-6]
Lugscheider, Erich
Herbst-Dederichs, Christian
Zhao, Lidong
[Contribution to a conference proceedings, Journal Article]
Corrosion tests of PVD coatings with die lubricant used for Al high-pressure die-casting dies
In: Surface & coatings technology, 108 (1/3), 408-412, 1998
[DOI: 10.1016/S0257-8972(98)00624-0]
Lugscheider, E.
Barimani, C.
Guerreiro, S.
Bobzin, Kirsten
[Journal Article]
Beschichtungen lassen Werkzeuge kalt
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 29 (9), 525-536, 1998
[DOI: 10.1002/mawe.19980290911]
Lugscheider, E.
Knotek, O.
Konig, W.
Stock, H. R.
Hellman, S.
Zimmermann, H.
Lake, M. K.
Fritsch, R.
Seidel, F.
[Journal Article]
Innenbeschichtung von Al-Motorblöcken mittels PVD-Technik
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 29 (12), 720-725, 1998
[DOI: 10.1002/mawe.19980291207]
Lugscheider, E.
Wolff, C.
[Journal Article]
Plasma-Pulverauftragschweißen - Vergleich von Standard- und Hochleistungsprozeß
In: Schweissen und Schneiden, 50 (2), 96-101, 1998
Lugscheider, Erich
Langer, G.
[Journal Article]
Simulation von Gleitverschleiß
In: Metall, 52, 643-651, 1998
Peterseim, J.
Elsing, R.
Deuerler, F.
[Journal Article]
Das Interview
In: Schweissen und Schneiden, 50, 332-333, 1998
Lugscheider, E.
[Contribution to a conference proceedings, Journal Article]
Parameter studies on high-velocity oxy-fuel spraying of MCrAIY coatings
In: Thin solid films, ..., 1998
Lugscheider, E.
Zhao, Lidong
Herbst, C.
[Journal Article]
Parameter studies on high-velocity oxy-fuel spraying of MCrAIY coatings
In: Surface & coatings technology, 108/109, 16-23, 1998
Lugscheider, E.
Zhao, Lidong
Herbst, C.
[Contribution to a conference proceedings, Journal Article]
Magnetronsputtered hard material coatings on thermoplastic polymers for clean room applications
In: Thin solid films, ..., 1998
Lugscheider, Erich
Bärwulf, Stephan
Barimani, Cyrus
Riester, M.
Hilgers, H.
[Contribution to a conference proceedings, Journal Article]
Investigation of new arc PVD coatings in the system Ti-Hf-C-N
In: Thin solid films, ..., 145-145, 1998
Lugscheider, E.
Knotek, O.
Zimmermann, H.
Stricker, S.
[Contribution to a conference proceedings, Journal Article]
Corrosion tests of PVD coatings with die dressing used for Al high-pressure die-casting dies
In: Thin solid films, ..., 1998
Lugscheider, Erich
Barimani, Cyrus
Guerreiro, S.
Bobzin, Kirsten
[Journal Article]
Vergleich verschiedener Meßmethoden zur Bestimmung der Partikelgröße von Pulvern zum Plasmaspritzen
In: Schweissen und Schneiden, 50, 724-731, 1998
Lugscheider, E.
Suk, H.-G.
Lee, H.-K.
[Journal Article]
Beschichtungstechnologien entwickeln sich mit den Anforderungen: Über den Masseneinsatz entscheidet ein konsequent durchgeführtes Qualitätsmanagement
In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 7 (2), 12-13, 1998
Lugscheider, E.
[Journal Article]
Analysis of a-BxCy:Hz coatings with IBA techniques
In: Nuclear instruments & methods in physics research / Section B, Beam interactions with materials and atoms, 136/138, 258-262, 1998
Lugscheider, Erich
Giorginis, G.
Persson, L.
Hult, M.
Siry, C. W.
Crametz, A.
[Journal Article]
Innenbeschichtung von Aluminium Motorblöcken mittels PVD-Technik - Teil 1
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 89 (2), 40-42, 1998
Lugscheider, Erich
Wolff, C.
[Journal Article]
Processing, structure and tribological behaviour of TiC-reinforced plasma sprayed coatings
In: Wear, 220 (1), 34-50, 1998
[DOI: 10.1016/S0043-1648(98)00237-3]
Economou, S.
de Bonte, Marc
Celis, Jean-Pierre
Smith, R. W.
Lugscheider, Erich
[Journal Article]
Plasma-arc powder surfacing - comparison of standard and high-productivity processes
In: Schweissen und Schneiden, 50, E28-E31, 1998
Lugscheider, Erich
Langer, G.
[Contribution to a book, Journal Article]
Wie High-Tech Beschichtungen laufen lernen : Oberflächenmodifikation an Bauteilen für die Medizintechnik
In: RWTH-Themen : Berichte aus der Rheinisch-Westfälischen Technischen Hochschule Aachen, 1998, 40-42, 1998
Kyeck, Sascha
Lake, Mark
Lugscheider, Erich
[Journal Article]
High-speed flame-sprayed chromium coatings for wear and corrosion protection
In: Schweissen und Schneiden, 50, E36-E39, 1998
Lugscheider, Erich
Reymann, H.
[Journal Article]
Ceramic thermal barrier coatings deposited with the electron beam-physical vapour deposition technique
In: Surface & coatings technology, 98 (1/3), 1221-1227, 1998
Lugscheider, Erich
Barimani, Cyrus
Döpper, G.
[Journal Article]
Hochgeschwindigkeitsflammgespritzte Chromschichten zum Verschleiß- und Korrosionsschutz
In: Schweissen und Schneiden, 50 (1), 44-47, 1998
Lugscheider, Erich
Reymann, H.
[Journal Article]
Possibilities and limits of the characterization of wear resistant PVD coatings by photothermal spectroscopy
In: Surface & coatings technology, 98 (1/3), 971-975, 1998
[DOI: 10.1016/S0257-8972(97)00308-3]
Hayn, G. v.
Knotek, O.
Lugscheider, Erich
Zimmermann, H.
Zimmermann, H.
[Journal Article]
(Cr:Al)N coatings deposited by cathodic vacuum ARC evaporation
In: Surface & coatings technology, 98 (1/3), 1233-1239, 1998
[DOI: 10.1016/S0257-8972(97)00238-7]
Lugscheider, Erich
Vetter, J.
Guerreiro, S.
[Journal Article]
Heat-resistant active brazing of silicon-nitride. Part 2: Metallurgical characterization of the braze joints
In: Welding journal, 77 (Suppl.), 103-109, 1998
Lugscheider, Erich
Tillmann, W.
Schlimbach, K.
Manter, C.
Indacochea, C. A.
[Journal Article]
Comparison of different measuring methods for the determination of the particle size of powders for plasma spraying
In: Schweissen und Schneiden, 50, E219-E222, 1998
Lugscheider, Erich
Suk, H.-G.
Lee, H.-K.
[Journal Article]
On the thermoelectric performance of plasma spray-formed iron disilicide
In: Journal of materials science / Letters, 17, 1487-1490, 1998
Lugscheider, Erich
Schilz, J.
Müller, E.
Schakenberg, K.
Ernst, H.
Kaysser, W. A.
Langer, G.
[Journal Article]
Wear and cutting performance of coated microdrills
In: Surface & coatings technology, 107, 191-196, 1998
Löffler, F.
[Journal Article]
Corrosion tests of PVD coatings with die dressing used for Al high-pressure die-casting dies
In: Surface & coatings technology, 108/109, 408-412, 1998
Lugscheider, Erich
Barimani, Cyrus
Guerreiro, S.
Bobzin, Kirsten
[Journal Article]
Magnetron-sputtered hard material coatings on thermoplastic polymers for clean room applications
In: Surface & coatings technology, 108/109, 398-402, 1998
Lugscheider, Erich
Bärwulf, Stephan
Barimani, Cyrus
Riester, C.
Hilgers, H.
[Contribution to a conference proceedings, Journal Article]
Investigations on hard coated reamers in different lubricant free cutting operations
In: Surface & coatings technology, 90 (1/2), 172-177, 1997
[DOI: 10.1016/S0257-8972(96)03114-3]
Lugscheider, Erich
Knotek, O.
Barimani, C.
Leyendecker, T.
Lemmer, O.
Wenke, R.
[Journal Article]
Induktives Auftragslöten von Verschleißschutzschichtenim kontinuierlichn Verfahrbetrieb
In: Schweissen und Schneiden, 49 (6), 356-358, 1997
Lugscheider, Erich
Schmoor, H.
[Journal Article]
Heat-resistant active brazing of silicon-nitride. P. 1: Mechanical evaluation of braze joints - a new class of palladium-based filler metals that wet to ceramics is tested for joint strenght and oxidation resistance
In: Welding journal, 76 (8), 300-304, 1997
Tillmann, W.
Schlimbach, K.
Manter, C.
Indacochea, J. E.
Lugscheider, Erich
[Journal Article]
PVD coatings for lubricant-free tribological applications
In: Wear, 209, 101-105, 1997
Knotek, O.
Lugscheider, Erich
Barimani, Cyrus
Möller, M.
[Journal Article]
Development and characterization of joining techniques for dispersion-strenghtened alumina
In: Welding journal, 76 (9), 349-355, 1997
Lugscheider, Erich
Burger, W.
Broich, U.
[Journal Article]
Fügen und Beschichten in der Produktion der Zukunft - Untersuchung von acht deutschen Forschungsinstituten innerhalb des Rahmenprojekts Produktion 2000
In: Der Praktiker, 49 (11), 516-520, 1997
Lugscheider, Erich
Kortenbruck, G.
von Hofe, D.
[Journal Article]
Structure and properties of PVD TiB2-Coatings
In: Journal of solid state chemistry, 133, 117-121, 1997
Knotek, Otto
Lugscheider, Erich
Barimani, Cyrus
Möller, M.
[Journal Article]
New materials increase applications for brazing - P.I: Process considerations, P.II: Industrial heating
In: The journal of thermal technology, 1997, Dez.-Dez., 1997
Smith, R.
Lugscheider, Erich
[Journal Article]
Continous inductive hard-surface brazing of wear-resisting layers
In: Welding and cutting, 49 (6), E93-E95, 1997
Lugscheider, Erich
Schmoor, H.
[Journal Article]
Continious inductive hard-surface brazing of wear-resisting layers
In: Schweissen und Schneiden, 49 (6), E 93, 1997
Lugscheider, Erich
Schmoor, H.
[Journal Article]
Fügen und Beschichten in der Produktion der Zukunft
In: Der Praktiker, 49 (11), 516-516, 1997
Lugscheider, Erich
Kortenbruck, G.
von Hofe, D.
[Journal Article]
Reactive plasma spraying of coatings containing in situ synthezised titanium hard phases
In: International journal of refractory and hard metals : R & HM, 15 (5/6), 311-315, 1997
Lugscheider, Erich
Jungklaus, H.
Zhao, Lidong
Reymann, H.
[Journal Article]
Entwicklung und Anwendung von PVD-Schichten zur Verschleißverringerung von Druckgießformen
In: Giesserei : die Zeitschrift für Technik, Innovation und Management, 84 (23), 17-23, 1997
Lugscheider, Erich
Barimani, Cyrus
Guerreiro, S.
[Journal Article]
Tribological properties of B—C thin films deposited by magnetron-sputter-ion plating method
In: Surface & coatings technology, 91 (3), 167-173, 1997
[DOI: 10.1016/S0257-8972(96)03105-2]
Lugscheider, Erich
Knotek, Otto
Siry, C. W.
[Contribution to a book, Contribution to a conference proceedings, Journal Article]
Arc PVD-coated cutting tools for modern machining applications
In: Thin solid films, 308/309, 1997
Lugscheider, Erich
Knotek, Otto
Barimani, Cyrus
Zimmermann, H.
[Journal Article]
Superstöchiometric PVD carbidic and carbonitridic coatings
In: Materials science & engineering / A, Structural materials: properties, microstructure and processing, 109, 1996
Knotek, O.
Lugscheider, Erich
Löffler, Frank
Bosserhoff, B.
[Journal Article]
Flammspritzen mit nachfolgendem Einschmelzen einer NiCrBSi-Legierung auf vergüteten Stählen
In: Schweissen und Schneiden, 48 (2), 116-125, 1996
Matthes, K.-J.
Weichbrodt, K.-H.
Lanzendörfer, G.
Lugscheider, E.
Nyland, A.
Sicking, R.
[Journal Article]
Mechanical properties of high-temperature brazed titanium materials
In: International journal of fatigue, 18 (6), 418-418, 1996
Lugscheider, Erich
Broich, U.
Weld, J.
[Journal Article]
Superstoichiometric PVD carbide coatings
In: Materials science & engineering / A, Structural materials: properties, microstructure and processing, 209 (1/2), 394-398, 1996
Lugscheider, Erich
Knotek, Otto
Löffler, Frank
Bosserhoff, B.
Schmitz, S.
[Journal Article]
Financiering binnen de EU van onderzoeksprogramma's toegespitst op duitsland
In: Materiaalkunde Nieuws, 1996 (4/April), 1996
Lugscheider, Erich
Krugers, J.-P.
Ladru, F.
[Journal Article]
Kinetic and microstructural aspects of the reaction layer at ceramic/metal braze joints
In: Journal of materials science : JMS, 31 (2), 445-452, 1996
Xu, R.
Lugscheider, Erich
Indacochea, J. E.
Tillmann, W.
[Journal Article]
Characterization of thermal sprayed bioactive coatings
In: Colloids and surfaces / B, Biointerfaces, 6 (1), 7 S., 1996
Lugscheider, Erich
Knepper, M.
Nyland, A.
[Journal Article]
PVD coatings for luricant-free tribological applications
In: Wear, 209, 101-105, 1996
Lugscheider, Erich
Knotek, Otto
Barimani, Cyrus
Möller, M.
[Journal Article]
Investigation of thermophysical properties of AIP coated cutting tools for dry machining
In: Surface & coatings technology, 86/87 (2), 803-808, 1996
Lugscheider, Erich
Geiler, H. D.
Lake, M.
Zimmermann, H.
[Journal Article]
Strength and microstructure of brazed cemented carbide and silicon nitride joints
In: Journal of materials processing technology, 58 (1), 13-23, 1996
[DOI: 10.1016/0924-0136(95)02103-5]
Lugscheider, Erich
Martens, L.
Tillmann, W.
Ziegler, G.
[Journal Article]
Modeling of the APS plasma spray process
In: Computational materials science, 7 (1/2), 109-114, 1996
Lugscheider, Erich
Barimani, Cyrus
Eckert, P.
Eritt, U.
[Journal Article]
Simulation of the deposition process in PVD-technology
In: Computational materials science, 7 (1/2), 154-158, 1996
[DOI: 10.1016/S0927-0256(96)00074-2]
Lugscheider, Erich
Knotek, Otto
Barimani, Cyrus
Eckert, P.
Hayn, G.
[Journal Article]
Sliding wear behaviour of thermally sprayed 75/25 Cr3C2/NiCr wear resistant coatings
In: Wear, 198, 251-266, 1996
[DOI: 10.1016/0043-1648(96)06983-9]
Mohanty, M.
Smith, R. W.
de Bonte, Marc
Celis, Jean-Pierre
Lugscheider, Erich
[Journal Article]
Comparison of the structure of PVD thin films deposited with different deposition energies
In: Surface & coatings technology, 86/87 (1), 177-183, 1996
Lugscheider, Erich
Barimani, Cyrus
Wolff, C.
Guerreiro, S.
Döpper, G.
[Journal Article]
Wirtschaftlichkeitsanalyse modernener Beschichtungsverfahren anhand ausgewählter Anwendungsbeispiele
In: Stahl, 1996 (4), 45-48, 1996
Lugscheider, Erich
May, J.
Wulfhorst, B.
Gries, T.
Bärwulf, Stephan
Bosserhoff, B.
[Journal Article]
Simulation von Strahlverschleiß
In: Metall, 50 (11), 713-722, 1996
Petersheim, J.
Elsing, Rainer
[Journal Article]
Effect of single impact damage on strength of alumina and zirconia-toughened alumina
In: Journal of materials science / Letters, 15, 1925-1926, 1996
Lugscheider, Erich
Huang, Xingija
Tu, Mingjing
[Journal Article]
Das Reib- und Verschleißverhalten von ungeschmierten Ti-Al-C-N-PVD-Schichten
In: Tribologie und Schmierungstechnik, 43 (2), 1996
Lugscheider, Erich
Löffler, Frank
Wolff, C.
[Journal Article]
Kriterien für die Auswahl von Beschichtungsverfahren
In: VDI-Z integrierte Produktion, 138 (1/2), 36-41, 1996
Nyland, A.
Kron, P. B.
Ellermeier, J.
Schierling, M.
[Contribution to a conference proceedings, Journal Article]
Deposition of arc TiAlN coatings with pulsed bias
In: Surface & coatings technology, 76-77 (Part 2), 700-705, 1995
[DOI: 10.1016/02578-9729(68)00090-]
Lugscheider, E.
Knotek, O.
Loffler, F.
Barimani, C.
Guerreiro, S.
Zimmermann, H.
[Journal Article]
Einsatz von Zwischenschichten zum Abbau von Spannungen in aktivgelöteten Siliciumnitrid-Stahl-Verbindungen
In: Schweissen und Schneiden, 47 (2), 97-107, 1995
Lugscheider, Erich
Tillmann, W.
Maier, H. R.
Magin, Michael
[Journal Article]
Einsatz von PVD-Beschichtungen zur Minimierung von Kühlschmierstoffen bei der Zerspanung
In: VDI-Z integrierte Produktion / Special, 1995, 1995
Lugscheider, Erich
Löffler, Frank
Barimani, Cyrus
Zimmermann, H.
[Journal Article]
Eigenschaften hart- und hochtemperaturgelöteter Titanverbindungen
In: Schweissen und Schneiden, 47, 197-205, 1995
Lugscheider, Erich
Broich, U.
Steffens, H.-D.
Ashoff, D.
[Journal Article]
Design of wear resistant NiCr-TiC plasma sprayed coatings based on modifications in the carbide and the binder phase
In: Wear, 185, 1995
Economou, S.
de Bonte, Marc
Celis, Jean-Pierre
Smith, R. W.
Lugscheider, Erich
[Journal Article]
Wirtschaftlichkeitsanalyse neuer Beschichtungstechnologien
In: VDI-Z integrierte Produktion, 137 (7//8), 42-46, 1995
Lugscheider, Erich
Gries, Thomas
Wulfhorst, Burkhard
May, Johannes
Bosserhoff, Bert Hans
[Journal Article]
PVD-Beschichtungen contra Kühlschmierstoff-Verbrauch
In: VDI-Z integrierte Produktion / Special, 1995 (4), 38-42, 1995
Lugscheider, Erich
Löffler, Frank
Barimani, Cyrus
Zimmermann, H.
[Journal Article]
Plasmaspritzen von Titanhartstoffen : Neue Möglichkeiten zum Verschleißschutz
In: Schweissen und Schneiden, 47, 822-831, 1995
Lugscheider, Erich
Jungklaus, H.
Wielage, B.
Henker, A.
[Journal Article]
Heat resistant active brazing of silicon-nitride : P. 1: Mechanical evaluation of braze joints
In: Welding journal, 74, 1995
Lugscheider, Erich
Tillmann, W.
Schlimbach, K.
Manter, C.
Indacochea, J. E.
[Journal Article]
Thick thermal barrier coatings for Diesel engines
In: Surface engineering, 11 (4), 1995
Lugscheider, Erich
Kvernes, I.
[Journal Article]
Thermal sprayed aluminium-silicon alloy coatings
In: Materials and manufacturing processes, 10, 837-841, 1995
Lugscheider, Erich
Jokiel, P.
Feldhege, M.
[Journal Article]
Tribological behaviour of TiC/TaC-reinforced cermet plasma sprayed coatings tested against sapphire
In: Wear, 185 (1/2), 93-110, 1995
[DOI: 10.1016/0043-1648(95)06597-0]
Economou, S.
de Bonte, Marc
Celis, Jean-Pierre
Roos, J. R.
Smith, R. W.
Lugscheider, Erich
Valencic, A.
[Journal Article]
Arc-evaporation of multicomponent MCrAlY cathodes
In: Surface & coatings technology, 74/75, 118-122, 1995
Lugscheider, Erich
Knotek, Otto
Löffler, F.
Beele, W.
Barimani, Cyrus
[Journal Article]
Deposition of arc-TiAIN coatings with pulsed bias
In: Surface & coatings technology, 76/77, 700-705, 1995
Lugscheider, Erich
Knotek, Otto
Löffler, Frank
Barimani, Cyrus
Guerreiro, S.
Zimmermann, H.
[Journal Article]
Steigerung der Warmfestigkeit der Bindephase von Cermets
In: Metall, 49, 326-336, 1995
Grewe, H.
Kolaska, H.
[Journal Article]
Entwicklung von hochtemperaturbeständigen Aktivlötverbindungen aus Nichtoxidkeramik
In: Metall, 48 (1), 27-33, 1994
Lugscheider, Erich
Tillmann, Walter
Weise, W.
[Contribution to a conference proceedings, Journal Article]
The wear behaviour of heat-treated PVD coatings
In: Surface & coatings technology, 68, 199-202, 1994
[DOI: 10.1016/0257-8972(94)90160-0]
Knotek, O.
Löffler, F.
Wolff, C.
Wolkers, L.
[Contribution to a conference proceedings, Journal Article]
Behaviour of CVD and PVD coatings under impact load
In: Surface & coatings technology, 68/69, 253-258, 1994
[DOI: 10.1016/0257-8972(94)90170-8]
Knotek, O.
Lugscheider, E.
Löffler, F.
Schrey, A.
Bosserhoff, B.
[Journal Article]
Plasma spraying of high-nitrogen-bearing steels for wear-resistant coatings and structural applications
In: Journal of materials engineering and performance, 3 (4), 476-483, 1994
[DOI: 10.1007/BF02645313]
Khatri, S.
Smith, R.
Jokiel, P.
Lugscheider, E.
Bohley, M.
[Journal Article]
TiO2 - PVD. Sputtertemperatur und Haftfestigkeit
In: Metalloberfläche : mo, 48, 40-45, 1994
Pyun, S.-I.
Yoon, Y.-G.
Hyun, S.-M.
Lugscheider, E.
Mathesius, R.
[Journal Article]
Verbesserung der Eigenschaften von Hartlegierungen durch auftraggeschweißte carbidische Verbundpulver
In: Schweissen und Schneiden, 46, 109-114, 1994
Lugscheider, E.
Ait-Mekideche, Azedine
Melzer, A.
[Journal Article]
Phase-relations in the c-cr-fe system in the vicinity of the (liquid+bcc+m23c6+m7c3) invariant equilibrium - experimental determinations and thermodynamic modeling
In: Zeitschrift für Metallkunde, 85 (5), 359-364, 1994
Kowalski, M.
Spencer, P. J.
Granat, K.
Drzeniek, H.
Lugscheider, E.
[Journal Article]
Subsequent sealing of thermally sprayed coatings to increase corrosion resistance
In: Surface engineering, 10, 46-51, 1994
Lugscheider, E.
Jokiel, P.
Messerschmidt, V.
Beckschulte, G.
[Journal Article]
Technologische Eigenschaften von Breitspaltlötverbindungen an Rohren
In: Schweissen und Schneiden, 46, 274-276, 1994
Lugscheider, E.
Schmoor, H.
[Journal Article]
Einsetzbarkeit gelöteter Chrom-Nickel-Stähle in Wässern
In: Der Praktiker, 46, 228-230, 1994
Brandl, W.
Steffens, H.-D.
Rukzinski, D.
Podleschny, R.
Lugscheider, E.
Minarski, P.
[Journal Article]
Neuartige Schweißzusatzwerkstoffe auf Fe-W-Ti-C-Basis gegen mineralischen Abrasivverschleiß
In: Braunkohle, Tagebautechnik - Neue Bergbautechnik, 45, 24-28, 1994
Lugscheider, Erich
Reymann, H.
[Journal Article]
Kupferbasis-Reaktionslote. Ein Lösungsweg zum Löten poröser Sinterstähle
In: Schweissen und Schneiden, 46, 425-429, 1994
Lugscheider, E.
Tillmann, W.
Feng, M. E. Z.
[Journal Article]
Zur Ausbildung von Reaktionsschichten bei aktivgelöteten nichtoxidischen Ingenieurkeramiken. T. 1: Grundlagen und Wechselwirkung zwischen Aktivmetallen und Siliciumnitrid
In: VTE : Aufbau- und Verbindungstechnik in der Elektronik, 1994, 156-162, 1994
Tillmann, W.
Lugscheider, E.
Gale, W. F.
[Journal Article]
Zur Ausbildung von Reaktionsschichten bei aktivgelöteten nichtoxidischen Ingenieurkeramiken. T. 2: Wechselwirkung zwischen Aktivmetallen und Siliciumcarbid sowie Aluminiumnitrid
In: VTE : Aufbau- und Verbindungstechnik in der Elektronik, 1994, 210-212, 1994
Tillmann, W.
Lugscheider, E.
Gale, W. F.
[Journal Article]
Möglichkeiten des stoffschlüssigen Fügens metallischer Verbundwerkstoffe. Eine Übersicht
In: Schweissen und Schneiden, 46, 543-549, 1994
Tillmann, W.
Lugscheider, E.
[Journal Article]
Cytotoxicity investigations of plasma sprayed calcium phosphate coatings
In: Journal of materials science / Materials in medicine, 5, 371-375, 1994
[DOI: 10.1007/BF00058966]
Lugscheider, E.
Knepper, M.
Heimberg, B.
Dekker, A.
Kirkpatrick, C. J.
[Journal Article]
Pulvermetallurgie im Wettbewerb
In: Met, 48, 899, 1994
Lugscheider, E.
Deiser, C.
[Journal Article]
Hochtemperatureigenschaften von MCrAlY(Ti,Hf) beschichtetem Ventilstahl X 45 CrSi 9 3 bei 600 und 700°C
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 24 (11), 397-403, 1993
[DOI: 10.1002/mawe.19930241110]
Lugscheider, Erich
Müller, U.
Holdinghausen, A.
[Contribution to a conference proceedings, Journal Article]
Performance behaviour of physical-vapour-deposition-coated cermets in interrupted-cut machining
In: Surface & coatings technology, 62 (1/3), 669-673, 1993
[DOI: 10.1016/0257-8972(93)90316-G]
Knotek, O.
Löffler, F.
Krämer, G.
[Journal Article]
Interessante Anwendungen für das Hochtemperaturlöten
In: Jahrbuch Schweißtechnik, 1994, 173-178, 1993
Lugscheider, E.
Tillmann, W.
Schmoor, H.
[Journal Article]
Plasmaspritzen - Verfahren, Anwendungen, Entwicklungen
In: Metall, 47, 230-236, 1993
Lugscheider, E.
Jokiel, P.
[Journal Article]
Werkstoff- und Prozeßentwicklung in der Beschichtungstechnik
In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 5 (3), 42-45, 1993
Lugscheider, E.
Westermann, U.
[Journal Article]
Evaluation of d.c.-plasma jet chemical vapour deposition for diamond coatings on tungsten carbide based cutting plates
In: Diamond and related materials, 2 (12), 1464-1466, 1993
[DOI: 10.1016/0925-9635(93)90013-R]
Lugscheider, E.
Müller, U.
[Journal Article]
Zuverlässiges belastbares Fügeverfahren für Motorenbau und Energietechnik
In: Handelsblatt : Deutschlands Wirtschafts- und Finanzzeitung, 63 (31.3.1993), 31, 1993
Lugscheider, E.
Tillmann, W.
Weise, W.
[Journal Article]
Methods for brazing ceramic and metal-ceramic joints
In: Materials and manufacturing processes, 8, 219-238, 1993
Lugscheider, E.
Tillmann, W.
[Journal Article]
Braze coat process combines with induction heating for deposition of wear-resistant materials
In: Welding journal, 72 (5), 55-59, 1993
Lugscheider, E.
Gundlfinger, K.
Schmoor, H.
[Journal Article]
Zukunftsweisende Tendenzen im Thermischen Spritzen
In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 5 (5/6), 70-72, 1993
Lugscheider, E.
Jokiel, P.
[Journal Article]
Titandisilizid - ein korrosionsbeständiger Hochtemperatur-Werkstoff mit metallischen Eigenschaften
In: Metall, 47, 741-745, 1993
Westermann, U.
Lugscheider, E.
Wonka, J.
[Journal Article]
Verarbeitung Cr3C2-verstärkter Nickelhartlegierungen durch das autogene Flammspritzen
In: Schweissen und Schneiden, 45, 494-498, 1993
Lugscheider, E.
Jokiel, P.
Reimann, H.
Heinrich, P.
[Journal Article]
Applying Cr3C2-reinforced nickel-based hard alloys by oxyacetylene flame spraying
In: Welding and cutting, 1993 (9), E163- E166, 1993
Lugscheider, E.
Jokiel, P.
Reimann, H.
Heinrich, P.
[Journal Article]
Verarbeitung wolframcarbidverstärkter Nickelhartlegierungen durch Flammspritzen
In: Schweissen und Schneiden, 45, 601-604, 1993
Lugscheider, E.
Jokiel, P.
Karduck, P.
Reimann, H.
Heinrich, P.
[Contribution to a conference proceedings, Journal Article]
Arc deposition of Ti-C and Ti-C-N using acetylene as a reactive gas
In: Vacuum, 43 (5/7), 645-648, 1992
[DOI: 10.1016/0042-207X(92)90098-H]
Knotek, Otto
Löffler, Frank
Krämer, G.
[Contribution to a conference proceedings, Journal Article]
Reproducible arc-PVD process management under various reactive gases
In: Vacuum, 43 (5/7), 567-571, 1992
[DOI: 10.1016/0042-207X(92)90079-C]
Knotek, Otto
Löffler, Frank
Krämer, G.
Stössel, C.
[Contribution to a conference proceedings, Journal Article]
Multicomponent and multilayer physically vapor-deposited coatings for cutting tools
In: Surface & coatings technology, 54 (1/3), 241-248, 1992
[DOI: 10.1016/0257-8972(92)90169-B]
Knotek, Otto
Löffler, Frank
Kramer, G.
[Journal Article]
Thermisches Spritzen
In: Keramische Zeitschrift, 44 (Beil.), 1-4, 1992
Eschnauer, H.
Lugscheider, E.
Müller, U.
Weber, T.
[Journal Article]
Entwicklung hochvakuumdichter Oxidkeramik-Metall-Lötverbindungen
In: Schweissen und Schneiden, 44, 92-96, 1992
Lugscheider, E.
Boretius, M.
[Journal Article]
Surface engineering of Diesel engine parts - new technological achievements in powders and coating microstructures
In: Powder metallurgy international : PMI, 24, 7-13, 1992
Kvernes, I.
Lugscheider, E.
[Journal Article]
Zusatzwerkstoffe zum Metall-Inertgasauftragschweißen
In: Schweissen und Schneiden, 44, 138-143, 1992
Lugscheider, E.
Deppe, E.
Ambroziak, Andrej
Melzer, A.
[Journal Article]
Weld filler materials for metal-arc inert gas surface welding
In: Welding and cutting, 1992 (3), E 50-E 53, 1992
Lugscheider, E.
Deppe, E.
Ambroziak, Andrej
Melzer, A.
[Journal Article]
Beschichtungen durch Vakuumplasmaspritzen
In: Technica : die Fachzeitschrift für die Maschinen-, Elektro- und Metallindustrie, 41 (9), 19-22, 1992
Lugscheider, E.
Born, K.
[Journal Article]
Modelling of temperature gradients and stress-strain distributions during the plasma spraying process
In: Powder metallurgy international : PMI, 24, 240-245, 1992
Borgerding, B.
Sölter, H.-J.
Lugscheider, E.
Simhan, K.
[Journal Article]
Kristalline Diamantschichten auf Schneidwerkzeugen
In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 4 (7/8), 42-44, 1992
Lugscheider, E.
Müller, U.
[Journal Article]
High-speed temperature measurement for on-line process control and quality assurance during plasma-spraying
In: Powder metallurgy international : PMI, 24, 169-175, 1992
Sölter, H.-J.
Müller, U.
Lugscheider, E.
[Journal Article]
Optimization of spraying process and laser treatment of CoNiCrA1Y
In: Journal of thermal spray technology : JTST, 1, 239-248, 1992
Lugscheider, E.
Hofmann, D.
Nicoll, A. R.
[Journal Article]
Hochvakuumdichte Keramik-Metall-Lötverbindungen
In: Metall, 46, 802-805, 1992
Lugscheider, E.
Boretius, M.
[Journal Article]
Comparison of properties of coatings produced by laser cladding and conventional methods
In: Journal of materials science & technology : JMST, 8, 657-665, 1992
Oberländer, B. C.
Lugscheider, E.
[Journal Article]
Fügen von Keramik bei hohen Betriebstemperaturen
In: Werkstoff und Innovation, 5 (5/6), 44-48, 1992
Lugscheider, E.
Tillmann, W.
[Journal Article]
Production of spherical powders - the first step for optimized thermal-sprayed apatite coatings
In: Journal of thermal spray technology : JTST, 1, 215-221, 1992
Lugscheider, E.
Knepper, M.
Gross, K. A.
[Journal Article]
Underwater plasma processing of stabilized zirconia for thermal barrier coatings
In: Journal of thermal spray technology : JTST, 1, 49-55, 1992
Lugscheider, E.
Rass, I.
[Journal Article]
Metallographische Präparation plasmagespritzter Borcarbid-Schichten
In: Praktische Metallographie = Practical metallography, 23, 501-512, 1992
Lugscheider, E.
Koch, D.
Limbach, R.
[Journal Article]
The development of high vacuum-tight oxide ceramic-metal brazed joints
In: Welding and cutting, 1992 (2), E 37-E 40, 1992
Lugscheider, E.
Boretius, M.
[Contribution to a book, Contribution to a conference proceedings, Journal Article]
Properties of arc-evaporated crn and (cr, al)n coatings
In: Surface & coatings technology, 45 (1/3), 53-58, 1991
[DOI: 10.1016/0257-8972(91)90205-B]
Knotek, Otto
Löffler, Frank
Scholl, H. J.
[Journal Article]
On the origin of compressive stress in PVD coatings : an explicative model
In: Surface & coatings technology, 46 (3), 265-274, 1991
[DOI: 10.1016/0257-8972(91)90169-W]
Knotek, Otto
Elsing, Rainer
Krämer, G.
Jungblut, F.
[Contribution to a conference proceedings, Journal Article]
Ti(c,n) coatings using the arc process
In: Surface & coatings technology, 46 (1), 39-46, 1991
[DOI: 10.1016/0257-8972(91)90148-P]
Ertürk, E.
Knotek, Otto
Burgmer, W.
Prengel, H.-G.
Heuvel, H. J.
Dederichs, H. G.
Stossel, C.
[Journal Article]
Magnetron-sputtered superhard coatings within the system Ti-B-C-N
In: Vacuum, 41 (7/9), 2184-2186, 1990
[DOI: 10.1016/0042-207X(90)94220-K]
Knotek, O.
Jungblut, F.
Breidenbach, R.
[Journal Article]
Untersuchungen zur Korrosionsbeständigkeit hochtemperaturgelöteter Werkstoffe in Trinkwasser
In: Schweissen und Schneiden, 41, 590-595, 1989
Lugscheider, E.
Minarski, P.
[Journal Article]
Werkstoffkundliche Untersuchungen zum Löten verschiedener orthodontischer Drähte
In: Journal of orofacial orthopedics, 50, 506-517, 1989
Hannemann, M.
Minarski, P.
Lugscheider, E.
Diedrich, P.
[Journal Article]
Entwicklung und Optimierung von Eisen-Chrom-Bor-Kohlenstoff-Legierungen für das Metallichtbogenschweißen von Hartauftragungen mit Fülldrahtelektroden
In: Schweissen und Schneiden, 41, 661-666, 1989
Drzeniek, H.
Granat, K.
Li, Z.
Lugscheider, E.
[Journal Article]
Erosionsverhalten von Nickelbasisloten beim Hochtemperaturlöten
In: Schweissen und Schneiden, 41, 342-345, 1989
Lugscheider, E.
Cosack, T.
[Journal Article]
Oberflächenvorbehandlung schwer benetzbarer metallischer Werkstoffe
In: Schweissen und Schneiden, 41, 221-225, 1989
Lugscheider, E.
Minarski, P.
[Journal Article]
Unterwasserplasmaspritzen - eine neue Verfahrensvariante
In: Schweissen und Schneiden, 41, 547-550, 1989
Lugscheider, E.
Bugsel, B.
[Journal Article]
Erosionsverhalten von Nickelbasisloten beim Hochtemperaturlöten
In: Schweissen und Schneiden, 41, 342-345, 1989
Lugscheider, E.
Cosack, T.
[Journal Article]
Laserunterstützte Beschichtungstechnologie - Verwirklichung neuer Werkstoffzustände mit dem Hochleistungslaser
In: Schweissen und Schneiden, 40 (9), 1988
Lugscheider, E.
[Journal Article]
Fügen von Hochleistungskeramik untereinander und mit Metall
In: Technische Mitteilungen : TM, 80 (4), 1987
Lugscheider, Erich
Krappitz, Harald
Boretius, M.
[Journal Article]
Stand und Entwicklungstendenzen beim Plasmaspritzen
In: Elektrowärme international : ewi, 45, B 190-B 195, 1987
Lugscheider, Erich
Weber, Thomas
[Journal Article]
Überwältigendes Anwendungspotential. Plasmaspritzen von Verschleiss- schutzschichten
In: Industrie-Anzeiger, 109 (83), 1987
Lugscheider, Erich