Articles in journals
Source | Author(s) |
---|---|
[Journal Article] Thermisch gespritzte Beschichtungen als Lösung zum Fügen von Stahl/Al-Verbundgussbauteilen In: Thermal spray bulletin, 16 (2), 108-114, 2023 | Bobzin, Kirsten Heinemann, Hendrik Erck, Marvin (Corresponding author) Körner, Johannes |
[Journal Article] Novel Fe-Based Amorphous Brazing Foils in the Quinary System Fe-Ni-Cr-Si-B In: Advanced engineering materials, 2300403, 2023 [DOI: 10.1002/adem.202300403] | Bobzin, Kirsten Heinemann, Hendrik Erck, Marvin Stryzhyboroda, Oleg Vinke, Sophie (Corresponding author) |
[Journal Article] Effect of CrAIN coating properties on impact fatigue of tool steel In: Surface and coatings technology, 471, Paper Nr. 129869, 12 Seiten, 2023 [DOI: 10.1016/j.surfcoat.2023.129869] | Bobzin, Kirsten Kalscheuer, Christian Tayyab, Muhammad (Corresponding author) |
[Journal Article] Oxidation and wear behavior of CrAlMoN with varied Mo-content for cutting Ti6Al4V In: Production engineering, 11 Seiten, 2023 [DOI: 10.1007/s11740-023-01218-2] | Bobzin, Kirsten Kalscheuer, Christian Stachowski, Nina Isabell Inge (Corresponding author) Dege, Jan Hintze, Wolfgang Möller, Carsten Ploog, Petter |
[Journal Article] Microstructural Modification by Redesigning the Chemical Composition of Ni 620 Filler Metal In: Advanced engineering materials, 2300318, 2023 [DOI: 10.1002/adem.202300318] | Bobzin, Kirsten Heinemann, Hendrik Erck, Marvin (Corresponding author) |
[Journal Article] Machine learning based model for plasma prediction in high power pulsed magnetron sputtering processes In: Thin solid films, 777, 139903, 8 Seiten, 2023 [DOI: 10.1016/j.tsf.2023.139903] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Janowitz, Julia (Corresponding author) |
[Contribution to a book, Journal Article] Prediction of OES intensity ratios based on coating unit data in HPPMS processes by ANN In: Journal of physics / D, 56 (36), 364001, 9 Seiten, 2023 [DOI: 10.1088/1361-6463/acd793] | Bobzin, Kirsten Kalscheuer, Christian Möbius, Max Philip Schulze, Christoph Franz Robert (Corresponding author) |
[Journal Article] Influence of Ti inoculation on the wetting behaviour and microstructure of various Ni-based brazing alloys in combination with X5CrNi18-10 In: Welding and cutting, 22 (1), 16-22, 2023 [DOI: 10.53192/WAC202301WAC16] | Bobzin, Kirsten Heinemann, Hendrik Erck, Marvin Vinke, Sophie (Corresponding author) |
[Journal Article] Correction to: Development of an Expert System for Prediction of Deposition Efficiency in Plasma Spraying In: Journal of thermal spray technology, 32 (6), 1908-1908, 2023 [DOI: 10.1007/s11666-023-01602-5] | Bobzin, Kirsten Heinemann, Hendrik Dokhanchi, Seyed Ruhollah (Corresponding author) |
[Journal Article] Investigation of novel nano-carbide wc/cocr coatings applied by hvaf In: Journal of thermal spray technology : JTST, 32, 1772-1779, 2023 [DOI: 10.1007/s11666-023-01607-0] | Bobzin, Kirsten Wietheger, Wolfgang Burbaum, E. Johann, Lukas Markus (Corresponding author) Rempe, L. J. Matikainen, V. Kanerva, U. Karhu, M. Lagerbom, J. Kaunisto, K. Lartigue, J.-F. |
[Journal Article] Triboactive coatings for wear and friction reduction in chain drives In: Tribology international, 185, 108562, 2023 [DOI: 10.1016/j.triboint.2023.108562] | Bobzin, Kirsten Kalscheuer, Christian Möbius, Max Philip (Corresponding author) Rank, Martin Oehler, Manuel Koch, Oliver |
[Journal Article] Local approaches for the fatigue strength assessment of brazed joints made of X5CrNi18-10 and Cu 110 considering brazed seam quality and failure behavior In: Welding in the world, 67 (7), 1833-1852, 2023 [DOI: 10.1007/s40194-023-01524-4] | Jöckel, A. (Corresponding author) Baumgartner, J. Tillmann, W. Bültena, J. Bobzin, Kirsten Heinemann, Hendrik Erck, Marvin |
[Journal Article] Numerical investigation of the effect of a nozzle extension on the plasma jet in multi-arc plasma spraying In: Journal of thermal spray technology : JTST, 32, 1856-1863, 2023 [DOI: 10.1007/s11666-023-01588-0] | Bobzin, Kirsten Heinemann, Hendrik Dokhanchi, Seyed Ruhollah (Corresponding author) |
[Journal Article] Schichtentwicklung für die potenzielle Anwendung in PEM-Wasserelektrolyse In: Thermal spray bulletin, 16 (1), 42-48, 2023 | Bobzin, Kirsten Zhao, Lidong Heinemann, Hendrik Burbaum, Elisa Radermacher, Katja |
[Journal Article] Tribological performance of (Cr,Al)N+Mo:W:Sg in fluid-free friction regime In: Wear : an international journal on the science and technology of friction, lubrication and wear, 512/513, 204557, 2022 [DOI: 10.1016/j.wear.2022.204557] | Bobzin, Kirsten Kalscheuer, Christian Thiex, Matthias (Corresponding author) |
[Contribution to a book, Journal Article] Influence of the etching process on the coating performance in dry tribological contacts In: Journal of vacuum science & technology : JVST / A, 41 (3), 033104, 13 Seiten, 2023 [DOI: 10.1116/6.0002363] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Schulze, Christoph Franz Robert (Corresponding author) |
[Journal Article] Vorteile durch gepulste Verdampfung In: Magazin für Oberflächentechnik, 77 (1/2), 36-38, 2023 | Bobzin, Kirsten Kalscheuer, Christian Möbius, Max Philip (Corresponding author) Eichenhofer, Gerhard |
[Contribution to a conference proceedings, Journal Article] Correlation Between Process Parameters and Particle In-flight Behavior in AC-HVAF In: Journal of thermal spray technology, 32 (2/3), 559-567, 2023 [DOI: 10.1007/s11666-023-01543-z] | Bobzin, Kirsten Heinemann, Hendrik Jasutyn, Kevin (Corresponding author) |
[Journal Article] Replication of Particle Trajectories in the Plasma Jet with Two Consecutive Residual Neural Networks In: Journal of thermal spray technology, 32 (5), 1447-1464, 2023 [DOI: 10.1007/s11666-023-01533-1] | Bobzin, Kirsten Heinemann, Hendrik Dokhanchi, Seyed Ruhollah (Corresponding author) Rom, Christian Michael |
[Journal Article] Calcia-magnesia-alumino-silicate-induced degradation of (Gd0.9Yb0.1)2Zr2O7 thermal barrier coatings prepared by plasma spray-physical vapor deposition (PS-PVD) In: Surface and coatings technology, 454, 129179, 2022 [DOI: 10.1016/j.surfcoat.2022.129179] | Li, Shan Chen, Wenbo Zhao, Lidong Guo, Hongbo (Corresponding author) |
[Journal Article] Development of Near Net Shaped Coatings for Reduced Postprocessing Costs in Valves In: Journal of thermal spray technology, 32 (2/3), 681-692, 2023 [DOI: 10.1007/s11666-023-01539-9] | Bobzin, Kirsten Heinemann, Hendrik Burbaum, Elisa Schulz, Marvin (Corresponding author) |
[Journal Article] Modeling the Droplet Impact on the Substrate with Surface Preparation in Thermal Spraying with SPH In: Journal of thermal spray technology : JTST, 32 (2/3), 599-608, 2023 [DOI: 10.1007/s11666-023-01534-0] | Bobzin, Kirsten Heinemann, Hendrik Jasutyn, Kevin (Corresponding author) Jeske, Stefan Rhys Bender, Jan Stephen Warkentin, Sergej Mokrov, Oleg Sharma, Rahul Reisgen, Uwe |
[Journal Article] 3D deformation modeling of CrAlN coated tool steel compound during nanoindentation In: Surface and coatings technology, 453, 129148, 2023 [DOI: 10.1016/j.surfcoat.2022.129148] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Schmauder, Siegfried Guski, Vinzenz Verestek, Wolfgang Tayyab, Muhammad (Corresponding author) |
[Journal Article] An Approach to Synthesize Thick α- and γ-Al2O3 Coatings by High-Speed Physical Vapor Deposition In: Advanced engineering materials, 25 (4), 2201195, 2022 [DOI: 10.1002/adem.202201195] | Bobzin, Kirsten Kalscheuer, Christian Hassanzadegan Aghdam, Parisa (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Development of an Expert System for Prediction of Deposition Efficiency in Plasma Spraying In: Journal of thermal spray technology : JTST, 32 (2/3), 643-656, 2022 [DOI: 10.1007/s11666-022-01494-x] | Bobzin, Kirsten Heinemann, Hendrik Dokhanchi, Seyed Ruhollah (Corresponding author) |
[Journal Article] DLC-Coated Thermoplastics : Tribological Analyses Under Dry and Lubricated Sliding Conditions In: Tribology letters, 71 (1), 2, 2022 [DOI: 10.1007/s11249-022-01663-7] | Bobzin, Kirsten Kalscheuer, Christian Thiex, Matthias (Corresponding author) Sperka, P. Hartl, M. Reitschuster, S. Maier, E. Lohner, T. Stahl, K. |
[Journal Article] Experimental study and thermodynamic modelling of the ternary system Fe-Ni-Si with re-modelling of the constituent binary systems In: Journal of alloys and compounds : JAL, 935 (2), 168118, 2022 [DOI: 10.1016/j.jallcom.2022.168118] | Witusiewicz, Viktor T. (Corresponding author) Stryzhyboroda, Oleg Vinke, Sophie Bobzin, Kirsten Hecht, Ulrike |
[Journal Article] Design and investigation of an FeSiBCNb metallic glass with low electrical and thermal conductivity In: Journal of alloys and compounds : JAL, 993, 167749, 2022 [DOI: 10.1016/j.jallcom.2022.167749] | Bobzin, Kirsten Wietheger, Wolfgang Burbaum, Elisa Johann, Lukas Martin (Corresponding author) Glushych, Viktor |
[Journal Article] Self-lubricating CrAlMoN high performance tool coatings for machining of TiAl6V4 In: Production engineering, 17 (3/4), 437-444, 2022 [DOI: 10.1007/s11740-022-01161-8] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Stachowski, Nina Isabell Inge (Corresponding author) Hintze, W. Möller, C. Ploog, P. |
[Journal Article] Neues aus dem Institut für Oberflächentechnik der RWTH Aachen In: Thermal spray bulletin, 15 (1), 8-10, 2022 | Bobzin, Kirsten Wietheger, Wolfgang |
[Journal Article] Altbewährt aber noch lange nicht erschöpft In: Magazin für Oberflächentechnik, 75 (3), 42-43, 2022 | Bobzin, Kirsten |
[Journal Article] DLC‑Coated Thermoplastics: Tribological Analyses under Lubricated Rolling‑Sliding Conditions In: Tribology letters, 70 (4), 121, 2022 [DOI: 10.1007/s11249-022-01664-6] | Reitschuster, S. (Corresponding author) Maier, E. Lohner, T. Stahl, K. Bobzin, Kirsten Kalscheuer, Christian Thiex, Matthias Sperka, P. Hartl, M. |
[Journal Article] Oxidation stability of chromium aluminum oxynitride hard coatings In: Surface and coatings technology, 449, 128927, 2022 [DOI: 10.1016/j.surfcoat.2022.128927] | Bobzin, Kirsten Kalscheuer, Christian Grundmeier, Guido De los Arcos, Teresa Kollmann, Sabrina Carlet, Marco (Corresponding author) |
[Journal Article] Thermisch gespritzte Beschichtungen für Trockengleitlager In: Thermal spray bulletin, 15 (2), 104-111, 2022 [DOI: 10.53192/TSB202202104] | Bobzin, Kirsten Heinemann, Hendrik Burbaum, Elisa Schulz, Marvin (Corresponding author) |
[Journal Article] Influence of the atmospheric plasma spraying parameters on the coating structure and the deposition efficiency of silicon powder In: The international journal of advanced manufacturing technology, 123, 35-47, 2022 [DOI: 10.1007/s00170-022-10008-6] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Heinemann, Hendrik Burbaum, Elisa |
[Journal Article] Bewertung thermisch gespritzter Oxidkeramiken für die Isolationsanwendungen in der Elektromobilität In: Thermal spray bulletin, 15 (2), 90-96, 2022 [DOI: 10.53192/TSB20220286] | Bobzin, Kirsten Heinemann, Hendrik Burbaum, Elisa@ |
[Journal Article] Kalorimetrische Analyse von ternären Fe-Ni-Si-Legierungen für neuartige Lötfolien auf Fe-Basis In: Schweissen und Schneiden, 74 (6), 368-373, 2022 | Bobzin, Kirsten Heinemann, Hendrik Hebing, Julian Stryzhyboroda, Oleg Vinke, Sophie |
[Journal Article] Adaptive (Cr,Al)N+Mo:Sg Coating for Highly‐Stressed Contacts under Dry Rolling‐Sliding Conditions In: Tribology international, 174, 107761, 2022 [DOI: 10.1016/j.triboint.2022.107761] | Bobzin, Kirsten Kalscheuer, Christian Thiex, Matthias (Corresponding author) Stahl, K. Lohner, T. Maier, E. Yilmaz, M. |
[Journal Article] High-Velocity Arc Spraying of Fe-based Metallic Glasses with High Si Content In: Journal of thermal spray technology : JTST, 31 (7), 2219-2228, 2022 [DOI: 10.1007/s11666-022-01433-w] | Bobzin, Kirsten Wietheger, Wolfgang Burbaum, Elisa Johann, Lukas Martin (Corresponding author) |
[Journal Article] From cathode to substrate : Plasma diagnostics on high power pulsed magnetron sputtering deposition of titanium nitride In: Thin solid films, 755, 139331, 2022 [DOI: 10.1016/j.tsf.2022.139331] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Schulze, Christoph Franz Robert (Corresponding author) |
[Journal Article] Influence of brazing process and gap size on the fatigue strength of shear and peel specimen In: Welding in the world, 66 (10), 1941-1955, 2022 [DOI: 10.1007/s40194-022-01304-6] | Jöckel, A. (Corresponding author) Baumgartner, J. Tillmann, W. Bültena, J. Bobzin, Kirsten Heinemann, Hendrik Hebing, Julian Erck, Marvin |
[Journal Article] Development of a novel green coating process with laser In: Scientific reports, 12 (1), 6314, 2022 [DOI: 10.1038/s41598-022-10351-4] | Zhong, Chongliang (Corresponding author) Backes, Gerhard Johann, Lukas Martin Kittel, Jochen Schopphoven, Thomas Küppers, Wolfgang |
[Journal Article] Entwicklung dichter Si-Beschichtungen mittels Atmosphärischen Plasmaspritzens In: Thermal spray bulletin, 15 (1), 34-40, 2022 [DOI: 10.53192/TSB20220126] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Wietheger, Wolfgang Burbaum, Elisa |
[Journal Article] Low-Temperature Physical Vapor Deposition TiAlCrSiN Coated High-Speed Steel : Comparison Between Shot-Peened and Polished Substrate Condition In: Advanced engineering materials, 24 (9), 2200099, 2022 [DOI: 10.1002/adem.202200099] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Hoffmann, Dennis Christopher (Corresponding author) Bergs, Thomas Uhlmann, Lars Heinz |
[Journal Article] Hybrid reactive sputtering of transition metal aluminum oxynitrides In: Thin solid films, 742, 139028, 2021 [DOI: 10.1016/j.tsf.2021.139028] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco (Corresponding author) Schulze, Christoph Franz Robert |
[Journal Article] Schneller und günstiger zum Ziel In: Magazin für Oberflächentechnik : mo, 76 (1/2), 32-35, 2022 | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Schulze, Christoph Franz Robert |
[Journal Article] Comparison of Ceramic Insulation Coatings via Impedance Spectroscopy In: Journal of thermal spray technology : JTST, 31 (5), 1556-1567, 2022 [DOI: 10.1007/s11666-022-01395-z] | Bobzin, Kirsten Wietheger, Wolfgang Burbaum, Elisa (Corresponding author) Hosenfeldt, Tim Bagcivan, Nazlim Öte, Mehmet Müller, Björn Kunde, Carsten Elsner, Anna-Lena |
[Journal Article] Triboaktive Beschichtungen : Neue Entwicklungen für fluidfrei geschmierte Stirnradverzahnungen In: Vakuum in Forschung und Praxis, 34 (1), 18-23, 2022 [DOI: 10.1002/vipr.202200771] | Bobzin, Kirsten Kalscheuer, Christian Thiex, Matthias (Corresponding author) |
[Journal Article] Application and benchmark of SPH for modeling the impact in thermal spraying In: Computational particle mechanics : CPM, 9, 1137-1152, 2022 [DOI: 10.1007/s40571-022-00459-9] | Jeske, Stefan Rhys (Corresponding author) Bender, Jan Stephen Bobzin, Kirsten Heinemann, Hendrik Jasutyn, Kevin Simon, Marek Sebastian Mokrov, Oleg Sharma, Rahul Reisgen, Uwe |
[Journal Article] Capturing the Influence of Jet Fluctuations on Particles in Plasma Spraying In: Journal of thermal spray technology, 31 (1/2), 59-69, 2022 [DOI: 10.1007/s11666-021-01307-7] | Bobzin, Kirsten Heinemann, Hendrik (Corresponding author) O'Brien, Andreas |
[Journal Article] CrN/AlN nanolaminates: Architecture, residual stresses, and cracking behavior In: Journal of vacuum science & technology / A, 40 (1), 013414, 2021 [DOI: 10.1116/6.0001462] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Maier, H. J. Heidenblut, T. Besserer, H.-B. Kahra, C. Janowitz, Julia (Corresponding author) |
[Journal Article] Impact Resistance and Properties of (Cr,Al,Si)N Coatings Deposited by Gas Flow Sputtering with Pulsed DC Supply In: Advanced engineering materials, 24 (4), 2101021, 2021 [DOI: 10.1002/adem.202101021] | Bobzin, Kirsten Kalscheuer, Christian Hassanzadegan Aghdam, Parisa (Corresponding author) |
[Journal Article] Durability of nanolayer Ti-Al-O-N hard coatings under simulated polycarbonate melt processing conditions In: Journal of physics / D, 55 (3), 035204, 2021 [DOI: 10.1088/1361-6463/ac2e31] | Brögelmann, Tobias Bobzin, Kirsten Grundmeier, G. de los Arcos, T. Kruppe, Nathan Christopher Schwiderek, S. Carlet, Marco (Corresponding author) |
[Journal Article] Crack Resistance of Diamond‐Like Carbon Coatings : Investigations with Nanoindentation In: Vakuum in Forschung und Praxis, 33 (6), 36-42, 2021 [DOI: 10.1002/vipr.202100769] | Bobzin, Kirsten Brögelmann, Tobias Carlet, Marco (Corresponding author) Kruppe, Nathan Christopher Engels, Martin Gottfried Arghavani, Mostafa |
[Journal Article] Self-lubricating CrAlVN coatings for turning of Ti6Al4V: oxidation and wear behavior In: Materials science and engineering technology, 52 (12), 1394-1412, 2021 [DOI: 10.1002/mawe.202100042] | Bobzin, Kirsten Brögelmann, Tobias Stachowski, Nina Isabell Inge (Corresponding author) Hintze, W. Möller, C. Ploog, P. |
[Journal Article] Tribologischer und korrosiver Einfluss von Grafit in thermisch gespritzten Cr3C2/NiCr-Beschichtungen In: Thermal spray bulletin, 14 (2), 112-119, 2021 | Bobzin, Kirsten Wietheger, Wolfgang Burbaum, Elisa Schulz, Marvin@ |
[Journal Article] Structural analyses of a CrN/AlN nanolaminate hard coating after nanoscratch test In: Thin solid films, 738, 138964, 2021 [DOI: 10.1016/j.tsf.2021.138964] | Bobzin, Kirsten Brögelmann, Tobias Mayer, Joachim Iskandar, Mohamad Riza Kruppe, Nathan Christopher Naderi, Mona (Corresponding author) |
[Journal Article] Influence of the Titanium Inoculation on the Melting Behavior and Microstructure of Ni 620/X38CrMoV5-1 Brazing Joints In: Advanced engineering materials, 23 (12), 2100497, 2021 [DOI: 10.1002/adem.202100497] | Bobzin, Kirsten Wietheger, Wolfgang Hebing, Julian (Corresponding author) |
[Journal Article] Understanding the Tribological Behavior of Graded (Cr,Al)N + Mo:S in Fluid-Free Friction Regime In: Tribology letters, 69 (4), 162, 2021 [DOI: 10.1007/s11249-021-01536-5] | Bobzin, Kirsten Kalscheuer, Christian Thiex, Matthias (Corresponding author) |
[Journal Article] Thermal stability of CrAlN/AlCrN nanolaminate coating deposited by hybrid dcMS/HPPMS after heat treatment with continuous-wave laser In: Applied surface science, 569, 151024, 2021 [DOI: 10.1016/j.apsusc.2021.151024] | Bobzin, Kirsten Brögelmann, Tobias Mayer, Joachim Aretz, Anke Iskandar, Mohamad Riza Kruppe, Nathan Christopher Naderi, Mona (Corresponding author) |
[Journal Article] Influence of Aluminum Content on the Impact Fatigue of HPPMS CrAlN Coatings on Tool Steel In: Physical mesomechanics, 24 (5), 625-632, 2021 [DOI: 10.1134/S1029959921050143] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Tayyab, Muhammad (Corresponding author) |
[Journal Article] Thermisch gespritzte Beschichtungen für den Armaturenbau In: Materials science and engineering technology, 52 (9), 997-1011, 2021 [DOI: 10.1002/mawe.202100032] | Bobzin, Kirsten Wietheger, Wolfgang Heinemann, Hendrik Schulz, Marvin (Corresponding author) Oechsner, Matthias Engler, T. Scheerer, H. Joung, Y. |
[Journal Article] Influence of a short reverse positive HPPMS pulse on the deposition of CrAlN In: Surface and coatings technology, 423, 127625, 2021 [DOI: 10.1016/j.surfcoat.2021.127625] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Eichenhofer, G. Schulze, Christoph Franz Robert (Corresponding author) |
[Journal Article] Influence of residual stresses in hard tool coatings on the cutting performance In: Journal of manufacturing processes, 69, 340-350, 2021 [DOI: 10.1016/j.jmapro.2021.08.011] | Bobzin, Kirsten Brögelmann, Tobias Maier, Hans Jürgen Heidenblut, Torsten Kahra, Christoph Carlet, Marco (Corresponding author) |
[Journal Article] HPPMS tool coatings: Chip formation and friction In: Vakuum in Forschung und Praxis, 33 (4), 26-33, 2021 [DOI: 10.1002/vipr.202100765] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Carlet, Marco (Corresponding author) Hoffmann, Dennis Christopher Breidenstein, Bernd Krödel-Worbes, Alexander Beblein, Sascha |
[Journal Article] Smart PVD hard coatings with temperature sensor function In: Surface and coatings technology, 423, 127631, 2021 [DOI: 10.1016/j.surfcoat.2021.127631] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Janowitz, Julia (Corresponding author) |
[Journal Article] Particle tailored effective particle-gas interaction coefficients during plasma spraying In: Thermal spray bulletin, 14 (1), 40-45, 2021 | Bobzin, Kirsten Wietheger, Wolfgang Heinemann, Hendrik Alkhasli, Ilkin |
[Journal Article] Prediction of Particle Properties in Plasma Spraying based on Machine Learning In: Journal of thermal spray technology, 30 (7), 1751-1764, 2021 [DOI: 10.1007/s11666-021-01239-2] | Bobzin, Kirsten Wietheger, Wolfgang Heinemann, Hendrik Dokhanchi, Seyed Ruhollah (Corresponding author) Rom, Christian Michael Visconti, Giuseppe |
[Journal Article] Pulse synchronized substrate bias for the High Power Pulsed Magnetron Sputtering deposition of CrAlN In: Thin solid films, 732, 138792, 2021 [DOI: 10.1016/j.tsf.2021.138792] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Engels, Martin Gottfried Schulze, Christoph Franz Robert (Corresponding author) |
[Journal Article] Design of a TiAlON multilayer coating : Oxidation stability and deformation behavior In: Surface and coatings technology, 421, 127417, 2021 [DOI: 10.1016/j.surfcoat.2021.127417] | Bobzin, Kirsten Kalscheuer, Christian Grundmeier, G. de los Arcos, T. Schwiderek, S. Carlet, Marco (Corresponding author) |
[Journal Article] Self-lubricating triboactive (Cr,Al)N+Mo:S coatings for fluid-free applications In: Journal of materials science, 56 (27), 15040-15060, 2021 [DOI: 10.1007/s10853-021-06255-9] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Thiex, Matthias (Corresponding author) |
[Journal Article] Use of displacement and force sensors to improve process control during induction brazing of carbide-steel joints In: Welding and cutting, 20 (1), 50-56, 2021 | Bobzin, Kirsten Wietheger, Wolfgang Hebing, Julian |
[Journal Article] Investigation on the incorporation of oxygen and thermal stability of HPPMS TiAlCrSiON nanolayer coatings In: Surface and coatings technology, 418, 127231, 2021 [DOI: 10.1016/j.surfcoat.2021.127231] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Carlet, Marco (Corresponding author) |
[Journal Article] Development of Thermal Spray Processes for Depositing Coatings on Thermoplastics In: Journal of thermal spray technology : JTST, 30 (1/2), 157-167, 2021 [DOI: 10.1007/s11666-020-01147-x] | Bobzin, Kirsten Wietheger, Wolfgang Knoch, Martin Andreas (Corresponding author) |
[Journal Article] DLC coated spur gears : Part II : coating properties and potential for industrial use In: Industrial Lubrication and Tribology, 73 (4), 621-634, 2021 [DOI: 10.1108/ILT-07-2020-0256] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Thiex, Matthias Schwarz, Andreas Ebner, Martin Lohner, Thomas Stahl, Karsten |
[Journal Article] STEM investigations of the influence of copper on alumina scale detachment during in-situ wetting experiments of Al-7Si-0.3Mg alloy with 95Sn-5Cu filler metal In: International journal of materials research : IJMR, 112 (5), 415-421, 2021 [DOI: 10.1515/ijmr-2020-8028] | Vayyala, Ashok Aretz, Anke Bobzin, Kirsten Wietheger, Wolfgang Hebing, Julian (Corresponding author) Iskandar, Mohamad Riza Mayer, Joachim Schmidt, Alexander |
[Journal Article] High-Speed Video Analysis of the Process Stability in Plasma Spraying In: Journal of thermal spray technology : JTST, 30 (4), 987-1000, 2021 [DOI: 10.1007/s11666-021-01159-1] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Alkhasli, Ilkin Heinemann, Hendrik (Corresponding author) |
[Journal Article] DLC-coated spur gears : part I: friction reduction In: Industrial lubrication & tribology, 73 (3), 457-469, 2021 [DOI: 10.1108/ILT-07-2020-0257] | Schwarz, Andreas Ebner, Martin Lohner, Thomas Stahl, Karsten Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Thiex, Matthias |
[Journal Article] Thermally sprayed sensor coatings for spatially resolved temperature detection In: Journal of materials processing technology, 291, 117043, 2021 [DOI: 10.1016/j.jmatprotec.2021.117043] | Bobzin, Kirsten Wietheger, Wolfgang Knoch, Martin Andreas Heinemann, Hendrik Schacht, Andreas (Corresponding author) Gillner, Arnold Hummel, Marc Daniel |
[Journal Article] Softening Behavior of Cold-Sprayed Aluminum-Based Coatings AA1200 and AA7075 During Annealing In: Journal of thermal spray technology : JTST, 30 (1/2), 358-370, 2020 [DOI: 10.1007/s11666-020-01121-7] | Bobzin, Kirsten Wietheger, Wolfgang Hebing, Julian Gerdt, Leonid (Corresponding author) |
[Journal Article] Enhancement of the insulation properties of thermal sprayed ceramic bearing coatings In: Bearing world journal, 5, 35-46, 2020 | Bobzin, Kirsten Wietheger, Wolfgang Knoch, Martin Andreas Burbaum, Elisa Hosenfeldt, Tim Bagcivan, Nazlim Öte, Mehmet Heckl, Astrid Müller, Björn Kunde, Carsten Elsner, Anna-Lena |
[Journal Article] HPPMS TiAlCrSiN - Influence of substrate bias and pulse frequency on cutting performance In: Surface and coatings technology, 397, 126056, 2020 [DOI: 10.1016/j.surfcoat.2020.126056] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Carlet, Marco (Corresponding author) |
[Journal Article] Steigerung der Leistungsfähigkeit technischer Kunststoffe durch DLC-Beschichtungen In: Tribologie und Schmierungstechnik, 67, 15-24, 2020 [DOI: 10.30419/TuS-2020-0014] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Thiex, Matthias |
[Contribution to a book, Contribution to a conference proceedings, Journal Article] PVD Coated Tools and Surface-Structured Workpieces in Dry Cold Forming of Steel In: Defect and diffusion forum, 404, 19-27, 2020 [DOI: 10.4028/www.scientific.net/DDF.404.19] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Bergs, Thomas Mattfeld, Patrick-Marcel Trauth, Daniel Hild, Rafael Hoffmann, Dennis Christopher (Corresponding author) |
[Contribution to a book, Contribution to a conference proceedings, Journal Article] Temperature Measurement on Tool Surfaces by Wear Resistant PVD Sensor Coatings In: Defect and diffusion forum, 404, 138-145, 2020 [DOI: 10.4028/www.scientific.net/DDF.404.138] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Janowitz, Julia (Corresponding author) |
[Contribution to a book, Contribution to a conference proceedings, Journal Article] Self-Lubricating PVD Hard Coatings Through Tribological Activation In: Defect and diffusion forum, 404, 109-116, 2020 [DOI: 10.4028/www.scientific.net/DDF.404.109] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Stachowski, Nina Isabell Inge (Corresponding author) |
[Journal Article] Combination of a laser deposition welded corrosion protection coating and a thermally sprayed wear protection coating In: Thermal spray bulletin, 13 (2), 114-121, 2020 | Bobzin, Kirsten Wietheger, Wolfgang Knoch, Martin Andreas Sommer, Jan Schleifenbaum, Johannes Henrich |
[Journal Article] Nutzung von Weg- und Kraftsensoren zur Verbesserung der Prozesskontrolle beim Induktionslöten von Hartmetall-Stahl-Fügeverbunden In: Schweissen und Schneiden, 72 (11), 694-701, 2020 | Bobzin, Kirsten Wietheger, Wolfgang Hebing, Julian |
[Journal Article] Effects of (Cr,Al)N and (Cr,Al,Mo)N coatings on friction under minimum quantity lubrication In: Surface and coatings technology, 402, 126154 -, 2020 [DOI: 10.1016/j.surfcoat.2020.126154] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian (Corresponding author) Stahl, K. Lohner, T. Yilmaz, M. |
[Journal Article] Brazed coatings for steam turbine blades : impact of the tape architecture and composition on mechanical properties In: International journal of materials research : IJMR, 111 (11), 916-922, 2020 [DOI: 10.3139/146.111956] | Bobzin, Kirsten Wietheger, Wolfgang Hebing, Julian Gerdt, Leonid (Corresponding author) Uddin, M. |
[Journal Article] Determination of local deposition efficiency based on in-flight particle diagnostics in plasma spraying In: Surface and coatings technology, 399, 126118, 2020 [DOI: 10.1016/j.surfcoat.2020.126118] | Bobzin, Kirsten Wietheger, Wolfgang Heinemann, Hendrik Dokhanchi, Seyed Ruhollah (Corresponding author) |
[Journal Article] Heating behaviour of plasma sprayed TiOx/Cr2O3 coatings for injection moulding In: Surface and coatings technology, 399, 126199, 2020 [DOI: 10.1016/j.surfcoat.2020.126199] | Bobzin, Kirsten Wietheger, Wolfgang Knoch, Martin Andreas Schacht, Andreas (Corresponding author) |
[Journal Article] Excellence cluster "Internet of Production" (IoP) of the RWTH Aachen - The digital world and production of the future In: Thermal spray bulletin, 13 (1), 12-14, 2020 | Brockmann, Matthias Wassong, Anja Bobzin, Kirsten Wietheger, Wolfgang Heinemann, Hendrik |
[Journal Article] Thermally sprayed coatings for highly stressed sliding bearings In: Wear : an international journal on the science and technology of friction, lubrication and wear, 458/459, 203415, 2020 [DOI: 10.1016/j.wear.2020.203415] | Bobzin, Kirsten Wietheger, Wolfgang (Corresponding author) Jacobs, Georg Bosse, Dennis Schröder, Tim Rolink, Amadeus Franziskus |
[Journal Article] Formation mechanisms of zinc, molybdenum, sulfur and phosphorus containing reaction layers on a diamond-like carbon (DLC) coating In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 51 (7), 1009-1030, 2020 [DOI: 10.1002/mawe.201900178] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Thiex, Matthias (Corresponding author) |
[Journal Article] Dry forming of low alloy steel materials by full forward impact extrusion with self-lubricating tool coatings and structured workpieces In: Dry metal forming open access journal : DMFOAJ, 6, 69-98, 2020 [DOI: 10.26092/elib/167] | Bobzin, Kirsten Klocke, Fritz Bergs, Thomas Brögelmann, Tobias Feuerhack, Andreas Kruppe, Nathan Christopher Hild, Rafael (Corresponding author) Hoffmann, Dennis Christopher (Corresponding author) |
[Journal Article] Further development of iron-based, titanium carbide reinforced thermal spray coatings for wear protection under corrosive loads In: Thermal spray bulletin, 13 (1), 44-51, 2020 | Bobzin, Kirsten Wietheger, Wolfgang Königstein, Tim Denis Stefan Zhao, Lidong malik, katarzyna maria |
[Journal Article] Key influencing factors for the thermal shock resistance of La2Zr2O7-based multilayer TBCs In: Surface and coatings technology, 396, 125951, 2020 [DOI: 10.1016/j.surfcoat.2020.125951] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Wietheger, Wolfgang Königstein, Tim Denis Stefan |
[Journal Article] A Visit to the Surface Engineering Institte (IOT) of RWTH Aachen University In: Thermal spray bulletin, 43 (1), 22-23, 2020 | Bobzin, Kirsten Wietheger, Wolfgang (Corresponding author) |
[Journal Article] Comparison of Residual Stress Measurements Conducted by X-ray Stress Analysis and Incremental Hole Drilling Method In: Journal of thermal spray technology : JTST, 29 (6), 1218-1228, 2020 [DOI: 10.1007/s11666-020-01056-z] | Bobzin, Kirsten Wietheger, Wolfgang Knoch, Martin Andreas Schacht, Andreas (Corresponding author) Reisgen, Uwe Sharma, Rahul Oster, Lukas Emmanuel |
[Journal Article] Approaches and possibilities for reducing residual stresses in induction brazed cemented carbide/steel joints In: Welding in the world, 64 (9), 1579-1587, 2020 [DOI: 10.1007/s40194-020-00928-w] | Bobzin, Kirsten Öte, Mehmet Hebing, Julian (Corresponding author) |
[Journal Article] Correlation of thermal characteristics and microstructure of multilayer electron beam physical vapor deposition thermal barrier coatings In: Thin solid films, 707, 138081, 2020 [DOI: 10.1016/j.tsf.2020.138081] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Yildirim, Baycan Welters, Martin (Corresponding author) |
[Journal Article] Influence of direct electric current on wetting behavior during brazing In: Frontiers of mechanical engineering, 15 (3), 496-503, 2020 [DOI: 10.1007/s11465-019-0582-6] | Bobzin, Kirsten Wietheger, Wolfgang Hebing, Julian Zhao, Lidong Schmidt, Alexander (Corresponding author) Iskandar, Mohamad Riza Mayer, Joachim |
[Journal Article] Macroscopic Modeling of an Agglomerated and Sintered Particle in Air Plasma Spraying In: Journal of thermal spray technology, 29, 13-24, 2019 [DOI: 10.1007/s11666-019-00964-z] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Alkhasli, Ilkin (Corresponding author) |
[Journal Article] Estimation of Particle Mass Flow Rate in Free Jet Using In-Flight Particle Diagnostics in Plasma Spraying In: Journal of thermal spray technology : JTST, 29 (5), pages921-931, 2020 [DOI: 10.1007/s11666-020-01027-4] | Bobzin, Kirsten Wietheger, Wolfgang Knoch, Martin Andreas Dokhanchi, Seyed Ruhollah (Corresponding author) |
[Journal Article] ITSC 2020: Amazing Opportunities Await In: Advanced materials & processes : AM&P, 178 (3), 36-36, 2020 | Bobzin, Kirsten |
[Journal Article] Deposition of a nanocomposite (Ti, Al, Si)N coating with high thickness by high-speed physical vapor deposition In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 51 (3), 297-312, 2020 [DOI: 10.1002/mawe.201900103] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Yildirim, Baycan Liang, Tiancheng (Corresponding author) |
[Journal Article] Influence of the Injector Head Geometry on the Particle Injection in Plasma Spraying In: Journal of thermal spray technology : JTST, 29 (4), 534-545, 2020 [DOI: 10.1007/s11666-020-01009-6] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Heinemann, Hendrik (Corresponding author) |
[Journal Article] Fatigue of brazed joints made of X5CrNi18-10 and Cu110 and derivation of reliable assessment approaches In: Welding in the world, 64 (4), 707-719, 2020 [DOI: 10.1007/s40194-020-00850-1] | Baumgartner, J. (Corresponding author) Tillmann, W. Bobzin, Kirsten Öte, Mehmet Wiesner, Stefanie Sievers, N. |
[Journal Article] Arc PVD (Cr,Al,Mo)N and (Cr,Al,Cu)N coatings for mobility applications In: Surface and coatings technology, 384, 125046, 2019 [DOI: 10.1016/j.surfcoat.2019.125046] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Self‐Lubricating Physical Vapor Deposition Coatings for Dry Cold Massive Forming In: Steel research international, 91 (5), 1900475, 2019 [DOI: 10.1002/srin.201900475] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Bergs, Thomas Trauth, Daniel Hild, Rafael Mannens, Robby Norbert Hoffmann, Dennis Christopher (Corresponding author) |
[Journal Article] Evalution of Two Repair Methods for Duplex-Coatings In: Thermal spray bulletin, 12 (2), 98-104, 2019 | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Prenger, Frank Jantze, Raphael Krömmer, Werner |
[Journal Article] Hochleistungsplasmen zur Entwicklung dünner Hartstoffschichten für Werkzeuge In: Werkstoffe in der Fertigung (2), 18-19, 2019 | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Carlet, Marco (Corresponding author) |
[Journal Article] Self-lubricating PVD Coatings in Interaction with Textured Workpiece Surfaces for Bulk Metal Forming In: Dry metal forming open access journal, 5, 39-45, 2019 | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Bergs, Thomas Hild, Rafael Feuerhack, Andreas Hoffmann, Dennis Christopher (Corresponding author) |
[Journal Article] Structure, mechanical characteristics and thermal stability of high speed physical vapor deposition (Al,Cr)2O3 coatings In: Thin solid films, 690, 137529, 2019 [DOI: 10.1016/j.tsf.2019.137529] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Welters, Martin (Corresponding author) |
[Journal Article] Wear behavior and thermal stability of HPPMS (Al,Ti,Cr,Si)ON, (Al,Ti,Cr,Si)N and (Ti,Al,Cr,Si)N coatings for cutting tools In: Surface and coatings technology, 385, 125370, 2019 [DOI: 10.1016/j.surfcoat.2020.125370] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Carlet, Marco (Corresponding author) |
[Journal Article] Modellierung des Tribosystems beim trockenen Vollvorwärtsfließ-pressen mithilfe eines erweiterten Reibmodells In: Dry metal forming open access journal, 5, 1-8, 2019 | Bergs, Thomas Hild, Rafael (Corresponding author) Feuerhack, Andreas Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Hoffmann, Dennis Christopher |
[Journal Article] Effects of the Ion to Growth Flux Ratio on the Constitution and Mechanical Properties of Cr1-x-Alx-N Thin Films In: ACS combinatorial science, 21 (12), 782-793, 2019 [DOI: 10.1021/acscombsci.9b00123] | Banko, Lars Ries, Stefan Grochla, Dario Arghavani, Mostafa Salomon, Steffen Pfetzing-Micklich, Janine Kostka, Aleksander Rogalla, Detlef Schulze, Julian Awakowicz, Peter Ludwig, Alfred (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Nanocomposite (Ti,Al,Cr,Si)N HPPMS coatings for high performance cutting tools In: Surface and coatings technology, 378, 124857, 2019 [DOI: 10.1016/j.surfcoat.2019.07.073] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Carlet, Marco (Corresponding author) |
[Journal Article] Investigation on the influence of oxygen on the deformation and cracking behavior of (Cr,Al)ON hard coatings using combinatorial static and dynamic loadings In: Journal of vacuum science & technology / A : JVST, 37 (6), 061509, 2019 [DOI: 10.1116/1.5124615] | Brögelmann, Tobias Bobzin, Kirsten Kruppe, Nathan Christopher Arghavani, Mostafa (Corresponding author) |
[Journal Article] Charakterisierung und Bewertung von Emissionen beim Thermischen Spritzen unter produktionsrelevanten Bedingungen In: Thermal spray bulletin, 12 (2), 78-87, 2019 | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan Wietheger, Wolfgang (Corresponding author) Kraus, Thomas Möller, Manfred |
[Journal Article] (Cr,Al)N and (Cr,Al,Mo)N hard coatings for tribological applications under minimum quantity lubrication In: Tribology international, 140, 105817, 2019 [DOI: 10.1016/j.triboint.2019.06.010] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian (Corresponding author) Stahl, K. Lohner, T. Yilmaz, M. |
[Journal Article] Post-annealing of (Ti,Al,Si)N coatings deposited by high speed physical vapor deposition (HS-PVD) In: Surface and coatings technology, 375, 752-762, 2019 [DOI: 10.1016/j.surfcoat.2019.06.100] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Liang, Tiancheng (Corresponding author) |
[Contribution to a book, Journal Article] Understanding the deformation and cracking behavior of Cr-based coatings deposited by hybrid direct current and high power pulse magnetron sputtering : From nitrides to oxynitrides In: Thin solid films, 688, 137354, 2019 [DOI: 10.1016/j.tsf.2019.06.004] | Brögelmann, Tobias Bobzin, Kirsten Kruppe, Nathan Christopher Arghavani, Mostafa (Corresponding author) |
[Journal Article] Influence of Microstructures on Thermal Shock and Sintering Behavior of YSZ-Based Thermal Barrier Coatings In: Surface technology, 48 (4), 28-33, 2019 [DOI: 10.16490/j.cnki.issn.1001-3660.2019.04.004] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Öte, Mehmet Königstein, Tim Denis Stefan |
[Journal Article] Laserstrukturierte nitridische und oxinitridische Beschichtungen abgeschieden mittels Mittelfrequenz‐Magnetron‐Sputtering In: International journal of material science, 50 (9), 1057-1069, 2019 [DOI: 10.1002/mawe.201800170] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Naderi, Mona (Corresponding author) |
[Journal Article] Incorporation of oxygen at column boundaries in (Cr,Al)ON hard coatings In: Thin solid films, 685, 275-281, 2019 [DOI: 10.1016/j.tsf.2019.06.047] | Brögelmann, Tobias Bobzin, Kirsten Kruppe, Nathan Christopher Carlet, Marco |
[Journal Article] Thermal Cyclic Oxidation Behavior of y-TiAl with in situ post-annealed Al-Si-Y Coating In: Journal of vacuum science & technology: JVST, 37 (4), 041401, 2019 [DOI: 10.1116/1.5094835] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Liang, Tiancheng (Corresponding author) |
[Journal Article] (Cr,Al)ON Deposited by Hybrid dcMS/HPPMS: A study on Incorporation of Oxygen In: Surface and coatings technology, 369, 238-243, 2019 [DOI: 10.1016/j.surfcoat.2019.04.066] | Brögelmann, Tobias Bobzin, Kirsten Kruppe, Nathan Christopher (Corresponding author) Carlet, Marco |
[Journal Article] Potenziale thermisch gespritzter Gleitlager für hochbelastete Lagerstellen In: Thermal spray bulletin, 12 (1), 31-37, 2019 | Bobzin, Kirsten Öte, Mehmet (Corresponding author) Königstein, Tim Denis Stefan (Corresponding author) Wietheger, Wolfgang (Corresponding author) |
[Journal Article] Bestimmung der Chromspezies beim Thermischen Spritzen In: Thermal spray bulletin, 41 (1), 18-19, 2019 | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan Wietheger, Wolfgang Kraus, Thomas Möller, Manfred |
[Contribution to a book, Journal Article] PVD-Schutzschichten für Werkzeuge des Präzisionsblankpressens In: Vakuum in Forschung und Praxis, 31 (2), 25-31, 2019 [DOI: 10.1002/vipr.201900711] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Stanek, Bonnie Naderi, Mona (Corresponding author) |
[Journal Article] Influence of Oxides on the Performance of Cylinder Bore Coatings of Engine Blocks In: Advanced composite materials, 21 (7), 1900006, 2019 [DOI: 10.1002/adem.201900006] | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Analysis of wear phenomena during forward extrusion under dry friction conditions In: Wear : an international journal on the science and technology of friction, lubrication and wear, 426/427 (B), 1362-1370, 2019 [DOI: 10.1016/j.wear.2019.01.127] | Hild, Rafael (Corresponding author) Bergs, Thomas Mattfeld, Patrick-Marcel Trauth, Daniel Klocke, Fritz Hoffmann, Dennis Christopher Kruppe, Nathan Christopher Brögelmann, Tobias Bobzin, Kirsten |
[Journal Article] Formation of Tribochemical Reaction Layers on a Metal Modified Amorphous Carbon Coating a-C:H:Zr (ZrCg) In: Tribology international, 135, 152-160, 2019 [DOI: 10.1016/j.triboint.2019.02.040] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Thiex, Matthias (Corresponding author) |
[Journal Article] A highly porous thermal barrier coating based on Gd2O3-Yb2O3 co-doped YSZ In: Surface and coatings technology, 366, 349-354, 2019 [DOI: 10.1016/j.surfcoat.2019.03.064] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Öte, Mehmet Königstein, Tim Denis Stefan |
[Journal Article] Effect of Different Atomization Gases on the Properties of Cylinder Bore Coatings In: Advanced engineering materials, 21 (2), 1800853, 2018 [DOI: 10.1002/adem.201800853] | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan (Corresponding author) |
[Journal Article] Development of a FeCrMnBC-based economical wear and corrosion resistant coating In: Surface and coatings technology, 362, 12-20, 2019 [DOI: 10.1016/j.surfcoat.2019.01.074] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Öte, Mehmet Königstein, Tim Denis Stefan |
[Journal Article] Wear behavior of HVOF-sprayed Al0.6TiCrFeCoNi high entropy alloy coatings at different temperatures In: Surface and coatings technology, 358, 215-222, 2018 [DOI: 10.1016/j.surfcoat.2018.11.052] | Chen, Lijia Bobzin, Kirsten Zhou, Zheng (Corresponding author) Zhao, Lidong Öte, Mehmet Königstein, Tim Denis Stefan Tan, Zhen He, Dingyong |
[Journal Article] Macroscopic particle modeling in air plasma spraying In: Surface and coatings technology, 364, 449-456, 2018 [DOI: 10.1016/j.surfcoat.2018.07.056] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Alkhasli, Ilkin (Corresponding author) |
[Journal Article] New Material Concepts for Thermally Sprayed Hydrodynamic Bearings In: Journal of thermal spray technology : JTST, 28 (1/2), 305-313, 2019 [DOI: 10.1007/s11666-018-0822-z] | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan Wietheger, Wolfgang (Corresponding author) Schröder, Tim Jacobs, Georg Bosse, Dennis |
[Journal Article] Influence of Powder Size on the Corrosion and Wear Behaviorof HVAF-Sprayed Fe-Based Coatings In: Journal of thermal spray technology : JTST, 28 (1/2), 63-75, 2018 [DOI: 10.1007/s11666-018-0819-7] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Sommer, Jan (Corresponding author) |
[Journal Article] Influence of HPPMS on Hybrid dcMS/HPPMS (Cr,Al)N Processes In: Surface and coatings technology, 358, 57-66, 2018 [DOI: 10.1016/j.surfcoat.2018.11.032] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher (Corresponding author) Engels, Martin Gottfried |
[Journal Article] Designing the Corrosion Products of ZnAl15: A new Approach to Smart Corrosion Protection Coatings? In: Corrosion science, 155, 217-229, 2017 [DOI: 10.1016/j.corsci.2017.12.015] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas (Corresponding author) |
[Journal Article] In situ Analyse beim Löten von Hartmetallen mittels Messungen des elektrischen Widerstandes In: Materials testing, 60 (4), 349-354, 2018 [DOI: 10.3139/120.111165] | Tillmann, Wolfgang Sievers, Norman (Corresponding author) Schmidt, Alexander Timmer, Christian |
[Journal Article] Neue Möglichkeiten für Fe-basis Beschichtungen durch HVAF-Spritzen In: 11. Kolloquium Hochgeschwindigkeits-Flammspritzen/HVOF Spraying, 25. und 26. Oktober 2018, Erding : Tagungsunterlagen : conference proceedings / GTS Europe, Linde - The Linde Group, 19-31, 2018 | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan Zhao, Lidong Sommer, Jan Malik, Katarzyna (Corresponding author) |
[Contribution to a book, Journal Article] Dünne PVD-Hartstoffschichten zur Online-Temperaturmessung : Datenerfassung in der Grenzfläche zwischen Werkzeug und Werkstück bzw. Schmelze In: Vakuum in Forschung und Praxis, 30 (6), 28-33, 2018 [DOI: 10.1002/vipr.201800699] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher (Corresponding author) Stalpers, Lore Janowitz, Julia |
[Journal Article] Einfluss der Bindereigenschaften und -zersetzung auf die Lötnahtqualität beim großflächigen Fügen mit Lotpasten In: Schweissen und Schneiden, 70 (6), 390-394, 2018 | Bobzin, Kirsten Öte, Mehmet Wiesner, Stefanie Hebing, Julian (Corresponding author) |
[Journal Article] Effect of Heat Treatment on the Phase Composition, Microstructure and Mechanical Properties of Al0.6CrFeCoNi and Al0.6CrFeCoNiSi0.3 High-Entropy Alloys In: Metals : open access journal, 8 (11), 974, 2018 [DOI: 10.3390/met8110974] | Chen, Lijia Bobzin, Kirsten Zhou, Zheng (Corresponding author) Zhao, Lidong Öte, Mehmet Königstein, Tim Denis Stefan Tan, Zhen He, Dingyong |
[Journal Article] Einfluss verunreinigter Oberflächenzustände auf das Benetzungsverhalten des Lots Ni 620 auf dem Grundwerkstoff 1.4301 In: Schweissen und Schneiden, 70 (8), 566-570, 2018 | Tillmann, Wolfgang (Corresponding author) Eilers, Arne (Corresponding author) Wojarski, Lukas (Corresponding author) Manka, Matthias (Corresponding author) Bobzin, Kirsten (Corresponding author) Öte, Mehmet (Corresponding author) Wiesner, Stefanie (Corresponding author) |
[Journal Article] Entwicklung von HPPMS‐Al2O3‐Beschichtungen für die Zerspanung von schwer zerspanbaren Werkstoffen In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 49 (11), 1287-1300, 2018 [DOI: 10.1002/mawe.201800008] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher (Corresponding author) Bastürk, Serhan Klocke, Fritz Gerschwiler, Klaus Kölker, W. Bolz, S. Kohlscheen, J. |
[Journal Article] Enhanced PVD process control by online substrate temperature measurement In: Surface and coatings technology, 354, 383-389, 2018 [DOI: 10.1016/j.surfcoat.2018.07.096] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher (Corresponding author) |
[Journal Article] Laser-structured high performance PVD coatings In: Surface and coatings technology, 352, 302-312, 2018 [DOI: 10.1016/j.surfcoat.2018.07.094] | Bobzin, Kirsten Brögelmann, Tobias Gillner, Arnold Kruppe, Nathan Christopher He, Chao Naderi, Mona |
[Journal Article] A contribution to the thermal effects of DLC coatings on fluid friction in EHL contacts In: Lubrication science, 30 (6), 285-299, 2018 [DOI: 10.1002/ls.1421] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Thiex, Matthias (Corresponding author) Ebner, M. Lohner, T. Stahl, K. |
[Journal Article] Thick HS-PVD (Al,Cr)2O3 coatings for challenging cutting and die casting applications In: Thin solid films, 663, 131-142, 2018 [DOI: 10.1016/j.tsf.2018.06.061] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Welters, Martin (Corresponding author) |
[Journal Article] Investigations on the substrate bias influence on reactive HPPMS plasmas In: Thin solid films, 663, 62-72, 2018 [DOI: 10.1016/j.tsf.2018.07.048] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Engels, Martin Gottfried (Corresponding author) |
[Journal Article] Al-Si and Al-Si-Y coatings deposited by HS-PVD for the oxidation protection of γ-TiAl In: Surface and coatings technology, 350, 587-595, 2018 [DOI: 10.1016/j.surfcoat.2018.06.074] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Liang, Tiancheng (Corresponding author) |
[Journal Article] In situ investigation of production processes in a large chamber scanning electron microscope In: Ultramicroscopy, 193, 151-158, 2018 [DOI: 10.1016/j.ultramic.2018.07.002] | Aretz, Anke Ehle, Lisa Christine Häusler, André Bobzin, Kirsten Öte, Mehmet Wiesner, Stefanie Schmidt, Alexander Gillner, Arnold Poprawe, Reinhart Mayer, Joachim (Corresponding author) |
[Journal Article] Correlation of HPPMS plasma and coating properties using artificial neural networks In: Surface and coatings technology, 349, 1130-1136, 2018 [DOI: 10.1016/j.surfcoat.2018.06.065] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa Engels, Martin Gottfried (Corresponding author) |
[Journal Article] Tribological studies on self-lubricating (Cr,Al)N+Mo:S coatings at elevated temperature In: Surface and coatings technology, 353, 282-291, 2018 [DOI: 10.1016/j.surfcoat.2018.06.067] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Hoffmann, Dennis Christopher (Corresponding author) Klocke, Fritz Mattfeld, Patrick-Marcel Trauth, Daniel Hild, Rafael |
[Journal Article] Reibungsreduzierung durch gradierte diamantähnliche Kohlenstoffschichten in EHD-Kontakten des Automobilantriebsstrangs In: Tribologie und Schmierungstechnik, 65 (1), 66-68, 2018 | Brögelmann, Tobias |
[Journal Article] 12. Aachener Oberflächentechnik Kolloquium : Bericht über die Veranstaltung am 8. Dezember 2017 in Aachen In: Galvanotechnik, 109 (3), 538-539, 2018 | Bobzin, Kirsten |
[Journal Article] High temperature oxidation behavior of Al0.6CrFeCoNi and Al0.6CrFeCoNiSi0.3 high entropy alloys In: Journal of alloys and compounds, 764, 845-852, 2018 [DOI: 10.1016/j.jallcom.2018.06.036] | Chen, Lijia Zhou, Zheng (Corresponding author) Tan, Zhen He, Dingyong Bobzin, Kirsten Zhao, Lidong Öte, Mehmet Königstein, Tim Denis Stefan |
[Journal Article] Physical Vapour Deposition : Hartstoffbeschichtungen für die Verarbeitung von Polymethylmethacrylat In: Galvanotechnik : Fachzeitschrift für die Praxis der Oberflächenbehandlung: Photovoltaik, Dünnschicht- und Plasmatechnik, Mikrosystemtechnik und Umwelttechnik, 109 (5), 873-884, 2018 | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Naderi, Mona |
[Journal Article] Development of HVAF-sprayed novel Fe-based coatings for large area applications In: Thermal spray bulletin, 11 (1), 38-45, 2018 | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Sommer, Jan |
[Journal Article] Prozessgrenzen beim Honen thermischer Spritzschichten : Honen korrosionsbeständiger und reibverlustmindernder Eisenbasisschichten für Bohrungsanwendungen In: wt Werkstattstechnik online, 1/2, 63-66, 2018 | Dröder, Klaus Hoffmeister, Hans-Werner Mahlfeld, Georg (Corresponding author) Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan (Corresponding author) Wank, Andreas (Corresponding author) Schläfer, Thomas Wessler, Tobias |
[Journal Article] Space-resolved plasma diagnostics in a hybrid (Cr,Al)N process In: Journal of vacuum science & technology / A, 36 (3), 031515, 2018 [DOI: 10.1116/1.5020151] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Engels, Martin Gottfried (Corresponding author) |
[Journal Article] Einfluss von Oberflächenstrukturierungen auf die Stempelkraft beim Vollvorwärtsfließpressen von 16MnCr5 In: Dry metal forming open access journal, 4, 25-30, 2017 | Klocke, Fritz Hild, Rafael (Corresponding author) Trauth, Daniel Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Hoffmann, Dennis Christopher |
[Journal Article] Developmement of Novel Fe-Based Coating Systems for Internal Combustion Engines In: Journal of thermal spray technology : JTST, 27 (4), 736-745, 2018 [DOI: 10.1007/s11666-018-0705-3] | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan (Corresponding author) Dröder, Klaus Hoffmeister, Hans-Werner Mahlfeld, Georg Schäfer, Thomas |
[Journal Article] Effect of Alloying Elements on Growth Behavior of Intermetallic Compounds at the Cold-Sprayed Coating/Steel Interface During Immersion in Aluminum Melt In: International journal of metalcasting : IJMC, 12 (4), 712-721, 2018 [DOI: 10.1007/s40962-017-0205-0] | Bobzin, Kirsten Öte, Mehmet Wiesner, Stefanie Gerdt, Leonid (Corresponding author) Bührig-Polaczek, Andreas Brachmann, Johannes |
[Journal Article] A novel approach for the prediction of deformation and fracture in hard coatings : Comparison of numerical modeling and nanoindentation tests In: Mechanics of materials, 117, 192-201, 2017 [DOI: 10.1016/j.mechmat.2017.11.006] | Rezaei, Shahed (Corresponding author) Arghavani, Mostafa Wulfinghoff, Stephan Kruppe, Nathan Christopher Brögelmann, Tobias Reese, Stefanie Bobzin, Kirsten |
[Journal Article] Transfer of Wire Arc-Sprayed Metal Coatings onto Plastic Parts In: Journal of thermal spray technology, 27 (1-2), 119-134, 2017 [DOI: 10.1007/s11666-017-0667-x] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Liao, Xifang (Corresponding author) Hopmann, Christian Ochotta, Philipp |
[Journal Article] Replication of micro-structured injection molds using physical vapor deposition coating and dynamic laser mold tempering In: Journal of polymer engineering, 38 (3), 315-322, 2017 [DOI: 10.1515/polyeng-2017-0131] | Hopmann, Christian Bobzin, Kirsten Brögelmann, Tobias Orth, Magnus Johannes (Corresponding author) Kruppe, Nathan Christopher Naderi, Mona |
[Journal Article] Impact wear of an HVOF-sprayed Cr3C2-NiCr coating In: International journal of refractory metals & hard materials, 70, 191-196, 2017 [DOI: 10.1016/j.ijrmhm.2017.10.011] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Öte, Mehmet Königstein, Tim Denis Stefan Steeger, Martin |
[Journal Article] Tribologischer Einsatz eisenbasierter Wärmedämmschichten in Verbrennungsmotoren In: Tribologie und Schmierungstechnik, 64 (3), 5-10, 2017 | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan Yao, Haihau |
[Journal Article] Mechanical and tribological characterization of self-lubricating (Cr1-xAlx)N coatings for deposition on complex-shaped forging tools In: Dry metal forming open access journal, 3, 81-89, 2017 | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa Hoffmann, Dennis Christopher Klocke, Fritz Mattfeld, Patrick-Marcel Trauth, Daniel Hild, Rafael (Corresponding author) |
[Journal Article] Korrelation der Haftzugfestigkeit thermisch gespritzter Beschichtungen mit der Substrattopografie In: Thermal spray bulletin, 10 (2), 118-125, 2017 | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Sommer, Jan (Corresponding author) |
[Journal Article] Beschichtungen für stoff- und formschlüssige Al-Schmelze/Stahlblech-Hybridbauteile In: Jahrbuch Oberflächentechnik, 73, 139-145, 2017 | Bobzin, Kirsten Bührig-Polaczek, Andreas Öte, Mehmet Wiesner, Stefanie Gerdt, Leonid (Corresponding author) Brachmann, Johannes |
[Journal Article] Physical Vapour Deposition : Hartstoffbeschichtungen für die Verarbeitung von Polymethylmethacrylat In: Jahrbuch Oberflächentechnik, 73, 116-127, 2017 | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Naderi, Mona |
[Contribution to a conference proceedings, Journal Article] High temperature oxidation protection of γ-titanium aluminide using (Cr,Al)ON coatings deposited by high-speed physical vapor deposition In: Surface and coatings technology, 332, 2-11, 2017 [DOI: 10.1016/j.surfcoat.2017.09.071] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Liang, Tiancheng (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Correlation of the Debye sheath thickness and (Cr,Al)N coating properties for HPPMS, dcMS, CAE and PCAE processes In: Surface and coatings technology, 332, 233-241, 2017 [DOI: 10.1016/j.surfcoat.2017.06.091] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Engels, Marita (Corresponding author) |
[Journal Article] Advanced deposition of hard a-C:Me coatings by HPPMS using Ne as process gas In: Surface and coatings technology, 332, 242-252, 2017 [DOI: 10.1016/j.surfcoat.2017.07.089] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Engels, Martin Gottfried (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Plastic deformation behavior of nanostructured CrN/AlN multilayer coatings deposited by hybrid dcMS/HPPMS In: Surface and coatings technology, 332, 253-261, 2017 [DOI: 10.1016/j.surfcoat.2017.06.092] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa (Corresponding author) Mayer, Joachim Weirich, Thomas E. |
[Journal Article] 11. Aachener Oberflächentechnik Kolloquium In: Galvanotechnik, 108, 1224-1225, 2017 | Bobzin, Kirsten |
[Journal Article] Triboactive CrAlN+X hybrid dcMS/HPPMS PVD nitride hard coatings for friction and wear reduction on components In: Surface and coatings technology, 332, 452-463, 2017 [DOI: 10.1016/j.surfcoat.2017.06.089] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian (Corresponding author) |
[Journal Article] Microstructural analysis of germanium modified tin-copper brazing filler metals for transient liquid phase bonding of aluminium In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 48 (12), 1257-1263, 2017 [DOI: 10.1002/mawe.201700155] | Iskandar, Mohamad Riza (Corresponding author) Schwedt, Alexander Mayer, Joachim Rochala, Patrick Wiesner, Stefanie Öte, Mehmet Bobzin, Kirsten Weirich, Thomas E. |
[Journal Article] Formation of the reaction zone between tin-copper brazing fillers and aluminum-silicon-magnesium alloys : Experiments and thermodynamic analysis In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 48 (12), 1241-1248, 2017 [DOI: 10.1002/mawe.201700152] | Bobzin, Kirsten Öte, Mehmet Wiesner, Stefanie Schmidt, Alexander (Corresponding author) Apel, M. Berger, R. Aretz, Anke Mayer, Joachim |
[Journal Article] Residual stress measurement in AlSi alloys In: Materialwissenschaft und Werkstofftechnik = Materialwissenschaft und Werkstofftechnik, 48 (12), 1270-1275, 2017 [DOI: 10.1002/mawe.201700157] | Reisgen, Uwe Sharma, Rahul (Corresponding author) Gach, Stefan Olschok, Simon Francis, J. Bobzin, Kirsten Öte, Mehmet Wiesner, Stefanie Knoch, Martin Andreas Schmidt, Alexander |
[Journal Article] Correlative plasma-surface model for metastable Cr-Al-N: Frenkel pair formation and influence of the stress state on the elastic properties In: Journal of applied physics, 121 (21), 215108, 2017 [DOI: 10.1063/1.4985172] | Music, Denis (Corresponding author) Banko, Lars Rueß, Holger Engels, Martin Gottfried Hecimovic, Ante Grochla, Dario Rogalla, Detlef Brögelmann, Tobias Ludwig, Alfred von Keudell, Achim Bobzin, Kirsten Schneider, Jochen M. |
[Journal Article] Thermal Conductivity and Wear Behavior of HVOF-Sprayed Fe-Based Amorphous Coatings In: Coatings : open access journal, 7 (10), 173, 2017 [DOI: 10.3390/coatings7100173] | Yao, Haihua Zhou, Zheng (Corresponding author) Wang, Liang Tan, Zhen He, Dingyong Zhao, Lidong |
[Journal Article] Enhanced replication ratio of injection molded plastic parts by using an innovative combination of laser-structuring and PVD coating In: Surface and coatings technology, 332, 474-483, 2017 [DOI: 10.1016/j.surfcoat.2017.09.068] | Bobzin, Kirsten Hopmann, Christian Gillner, Arnold Brögelmann, Tobias Kruppe, Nathan Christopher Orth, Magnus Johannes Steger, Michael Naderi, Mona (Corresponding author) |
[Journal Article] Entwicklung einer neuartigen wirtschaftlichen, eisenbasierten Beschichtung zur Erhöhung der Lebensdauer von Gussbauteilen unter dem Gesichtspunkt der Korrosionsbeständigkeit In: Materialwissenschaft und Werkstofftechnik, 48 (9), 922-935, 2017 [DOI: 10.1002/mawe.201700165] | Bobzin, Kirsten Zhao, Lidong Öte, Mehmet Königstein, Tim Denis Stefan Oechsner, M. Siebers, M. (Corresponding author) Andersohn, G. Ellermeier, J. |
[Contribution to a conference proceedings, Journal Article] A Contribution to explain the Mechanisms of Adhesive Wear in Plastics Processing by example of Polycarbonate In: Surface and coatings technology, 332, 464-473, 2017 [DOI: 10.1016/j.surfcoat.2017.07.080] | Bobzin, Kirsten Brögelmann, Tobias Grundmeier, Guido de los Arcos, Teresa Wiesing, M. Kruppe, Nathan Christopher (Corresponding author) |
[Contribution to a book, Contribution to a conference proceedings, Journal Article] Simulation of the Particel Melting Degree in air Plasma Spraying In: Journal of physics / Conference Series, 825, 012002, 2017 [DOI: 10.1088/1742-6596/825/1/012002] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Alkhasli, Ilkin (Corresponding author) Reisgen, Uwe Mokrov, Oleg Lisnyi, Oleksii |
[Journal Article] Kunststoffe metallisieren In: KunststoffXtra : Fachberichte, Messen, News, 7 (1/2), 11-15, 2017 | Hopmann, Christian Ochotta, Philipp (Corresponding author) Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Liao, Xifang |
[Journal Article] Fundamental study of an industrial reactive HPPMS (Cr,Al)N process In: Journal of applied physics, 122 (1), 015302, 2017 [DOI: 10.1063/1.4990997] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Engels, Martin Gottfried (Corresponding author) von Keudell, A. Hecimovic, A. Ludwig, A. Grochla, Dario Banko, Lars |
[Journal Article] Mechanical and tribiological characterization of self-lubricating (Cr1-xAlx)N coatings for deposition on complex-shaped forging tools In: Dry metal forming open access journal, 3, 81-89, 2017 [DOI: 10.18154/RWTH-2017-06971] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa (Corresponding author) Hoffmann, Dennis Christopher Klocke, Fritz Mattfeld, Patrick-Marcel Trauth, Daniel Hild, Rafael |
[Journal Article] Investigations on Mechanical and Tribological Behavior of dcMS/HPPMS CrN and (Cr,Al)N Hard Coatings Using Nanoscratch Technique In: Advanced engineering materials, 19 (6), 1600632, 2017 [DOI: 10.1002/adem.201600632] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa (Corresponding author) |
[Journal Article] Nitridische und oxinitridische HPPMS-Beschichtungen für den Einsatz in der Kunststoffverarbeitung (Teil 2) : Einfluss einer Sauerstoffvariation in (Cr,Al)ON-Beschichtungen auf die chemische Zusammensetzung der nativen Reaktionsschicht, sowie das Benetzungsverhalten gegenüber geschmolzenem und die Haftzugfestigkeit von erstarrtem Polycarbonat In: Vakuum in Forschung und Praxis, 29 (1), 24-28, 2017 [DOI: 10.1002/vipr.201700634] | Bobzin, Kirsten Grundmeier, Guido Brögelmann, Tobias de los Arcos, Teresa Wiesing, Martin Kruppe, Nathan Christopher (Corresponding author) |
[Journal Article] High-rate deposition of thick (Cr,Al)ON coatings by high speed physical vapor deposition In: Surface and coatings technology, 322, 152-162, 2017 [DOI: 10.1016/j.surfcoat.2017.05.034] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Liang, Tiancheng (Corresponding author) |
[Journal Article] Thermal cycling and isothermal oxidation behavior of quadruple EB-PVD thermal barrier coatings In: Materialwissenschaft und Werkstofftechnik, 48 (6), 502-518, 2017 [DOI: 10.1002/mawe.201600723] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Yildirim, Baycan Welters, Martin (Corresponding author) |
[Journal Article] How dry is dry? A critical analysis of surface conditions used in dry metal forming In: Dry metal forming open access journal, 3, 90-94, 2017 | Almohallami, Amer Arghavani, Mostafa Böhmermann, F. Freiße, H. Herrmann, M. Mousavi, S. A. Schöler, S. Scholz, P. Tenner, J. Umlauf, Georg Teller, Marco Wulff, D. Yilkiran, D. Maier, Hans Jürgen (Corresponding author) |
[Journal Article] Untersuchung der Einflussfaktoren auf die Übertragung von lichtbogendrahtgespritzten Zn-Beschichtungen für die Metallisierung von Kunststoffbauteilen In: Thermal spray bulletin, 10 (1), 43-49, 2017 | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Liao, Xifang Hopmann, Christian Ochotta, Philipp |
[Journal Article] Trockenumformung von 42CrS4 mittels Vollvorwärtsfließpressen durch strukturierte Halbzeugoberflächen und selbstschmierende Werkzeugbeschichtungen In: Dry metal forming open access journal, 4, 7-12, 2017 [DOI: 10.18154/RWTH-2017-04884] | Klocke, Fritz Hild, Rafael (Corresponding author) Trauth, Daniel Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa |
[Journal Article] Numerical Study on Plasma Jet and Particle Behavior in Multi-arc Plasma Spraying In: Journal of thermal spray technology : JTST, 26 (5), 811-830, 2017 [DOI: 10.1007/s11666-017-0564-3] | Bobzin, Kirsten Öte, Mehmet (Corresponding author) Schein, J. Zimmermann, S. |
[Contribution to a conference proceedings, Journal Article] Numerical Coupling of the Particulate Phase to the Plasma Phase in Modeling of Multi-Arc Plasma Spraying In: Journal of physics / Conference Series, 825, 012003, 2017 [DOI: 10.1088/1742-6596/825/1/012003] | Bobzin, Kirsten Öte, Mehmet (Corresponding author) |
[Journal Article] High-performance coatings for cutting tools In: CIRP journal of manufacturing science and technology : CIRP-JMST, 18, 1-9, 2016 [DOI: 10.1016/j.cirpj.2016.11.004] | Bobzin, Kirsten (Corresponding author) |
[Journal Article] Investigation of Amorphous/Nanocrystalline Iron-Based Thermal Barrier Coatings In: Journal of thermal spray technology : JTST, 26 (3), 388-397, 2017 [DOI: 10.1007/s11666-016-0520-7] | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan (Corresponding author) |
[Journal Article] Influence of Feedstock Materials and Spray Parameters on Thermal Conductivity of Wire-Arc-Sprayed Coatings In: Journal of materials engineering and performance, 26 (3), 1108-1113, 2017 [DOI: 10.1007/s11665-017-2567-0] | Yao, H. H. Zhou, Zhe (Corresponding author) Wang, G. H. He, D. Y. Bobzin, Kirsten Zhao, Lidong Öte, Mehmet Königstein, Tim Denis Stefan |
[Journal Article] Microstructure and Properties of FeCrB Alloy Coatings Prepared by Wire-Arc Spraying In: Journal of thermal spray technology : JTST, 26 (3), 483-491, 2017 [DOI: 10.1007/s11666-016-0510-9] | Yao, H. H. Zhou, Zhe (Corresponding author) Wang, Yu-Ming He, D. Y. Bobzin, Kirsten Zhao, Lidong Öte, Mehmet Königstein, Tim Denis Stefan |
[Journal Article] Surface Pre-treatment for Thermally Sprayed ZnAl15 Coatings In: Journal of thermal spray technology : JTST, 26 (3), 464-472, 2017 [DOI: 10.1007/s11666-016-0507-4] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas (Corresponding author) |
[Journal Article] Modeling Plasma-Particle Interaction in Multi-Arc Plasma Spraying In: Journal of thermal spray technology : JTST, 26 (3), 279-291, 2017 [DOI: 10.1007/s11666-016-0514-5] | Bobzin, Kirsten Öte, Mehmet (Corresponding author) |
[Journal Article] Characterization of DC magnetron plasma in Ar/Kr/N 2 mixture during deposition of (Cr,Al)N coating In: Journal of physics / D, Applied physics, 50 (7), 075203, 2017 [DOI: 10.1088/1361-6463/aa4ea2] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, S. Brugnara, Ricardo H. Bibinov, N. (Corresponding author) Awakowicz, P. |
[Journal Article] Influence of long time post annealing on thermal stability and thermophysical properties of plasma sprayed La2Zr2O7 coatings In: Journal of alloys and compounds : JAL, 695, 2549-2555, 2016 [DOI: 10.1016/j.jallcom.2016.10.328] | Erdogan, Garip (Corresponding author) Ustel, Fatih Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Zhao, Lidong |
[Journal Article] Evaluation of the shear stresses on surface structured workpieces in dry forming using a novel pin-on-cylinder tribometer with axial feed In: International journal of material forming, 10 (4), 557-565, 2016 [DOI: 10.1007/s12289-016-1301-z] | Trauth, Daniel (Corresponding author) Bastürk, Serhan Hild, Rafael Mattfeld, Patrick-Marcel Brögelmann, Tobias Bobzin, Kirsten Klocke, Fritz |
[Contribution to a conference proceedings, Journal Article] Novel Fe-based wear and corrosion resistant coatings by three-cathode plasma technology In: Surface and coatings technology, 318, 288-292, 2016 [DOI: 10.1016/j.surfcoat.2016.08.041] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Öte, Mehmet Königstein, Tim Denis Stefan |
[Journal Article] Nitridische und oxinitridische HPPMS-Beschichtungen für den Einsatz in der Kunststoffverarbeitung (Teil 1) : Einfluss einer Sauerstoffvariation auf Schichteigenschaften von (Cr,Al)ON und Verbundeigenschaften zwischen Beschichtung und Kunststoffformenstahl In: Vakuum in Forschung und Praxis, 28 (6), 28-33, 2016 [DOI: 10.1002/vipr.201600632] | Bobzin, Kirsten Grundmeier, Guido Brögelmann, Tobias de los Arcos, Teresa Wiesing, Martin Kruppe, Nathan Christopher (Corresponding author) |
[Journal Article] Reactive Air Brazing In: Info-Service (34), 2-6, 2016 | Kopp, Nils Bobzin, Kirsten Wiesner, Stefanie |
[Journal Article] TiC-verstärkte, stahlbasierte Werkstoffverbunde und innovative Implementierung im thermischen Spritzen In: Dialog, 5, 92-102, 2016 | Bobzin, Kirsten Zhao, Lidong Öte, Mehmet Link, Thomas |
[Contribution to a conference proceedings, Journal Article] On the plastic deformation of chromium-based nitride hard coatings deposited by hybrid dcMS/HPPMS: A fundamental study using nanoscratch test In: Surface and coatings technology, 308, 298-306, 2016 [DOI: 10.1016/j.surfcoat.2016.05.093] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa (Corresponding author) Mayer, Joachim Weirich, Thomas E. |
[Contribution to a conference proceedings, Journal Article] Synthesis of a-C coatings by HPPMS using Ar, Ne and He as process gases In: Surface and coatings technology, 308, 80-89, 2016 [DOI: 10.1016/j.surfcoat.2016.07.099] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Engels, Marita (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Influence of dcMS and HPPMS in a dcMS/HPPMS hybrid process on plasma and coating properties In: Thin solid films, 620, 188-196, 2016 [DOI: 10.1016/j.tsf.2016.07.079] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Engels, Martin Gottfried (Corresponding author) |
[Journal Article] Thermisch gespritzte Gleitlagerwerkstoffe für die Rotorlagerung von Windenergieanlagen In: Ingenieur-Spiegel : Fachmagazin für Ingenieure / Hellblaue Ausgabe, 2016 (4), 28-29, 2016 | Schröder, Tim (Corresponding author) Jacobs, Georg Bosse, Dennis Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan Wietheger, Wolfgang |
[Journal Article] Hybrid dcMS/HPPMS PVD nitride and oxynitride hard coatings for adhesion and abrasion reduction in plastics processing In: Surface and coatings technology, 308, 349-359, 2016 [DOI: 10.1016/j.surfcoat.2016.07.103] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian (Corresponding author) Naderi, Mona |
[Contribution to a conference proceedings, Journal Article] Efficiency improvement in automobile bucket tappet/camshaft contacts by DLC coatings : Influence of engine oil, temperature and camshaft speed In: Surface and coatings technology, 308, 360-373, 2016 [DOI: 10.1016/j.surfcoat.2016.09.041] | Dobrenizki, L. Tremmel, S. Wartzack, Sandro Hoffmann, Dennis Christopher Brögelmann, Tobias (Corresponding author) Bobzin, Kirsten Bagcivan, Nazlim Musayev, Y. Hosenfeldt, T. |
[Contribution to a conference proceedings, Journal Article] Analysis of CrN/AlN/Al2O3 and two industrially used coatings deposited on die casting cores after application in an aluminum die casting machine In: Surface and coatings technology, 308, 374-382, 2016 [DOI: 10.1016/j.surfcoat.2016.09.040] | Bobzin, Kirsten Brögelmann, Tobias Hartmann, U. Kruppe, Nathan Christopher (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] (Cr,Al)N/(Cr,Al)ON Oxy-nitride Coatings deposited by Hybrid dcMS/HPPMS for Plastics Processing Applications In: Surface and coatings technology, 308, 394-403, 2016 [DOI: 10.1016/j.surfcoat.2016.07.093] | Bobzin, Kirsten Brögelmann, Tobias Grundmeier, G. de los Arcos, Teresa Wiesing, M. Kruppe, Nathan Christopher (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Synthesis, characterization, and tribological evaluation of HPPMS (Cr1 − xAlx)N + MoSy coatings In: Surface and coatings technology, 308, 383-393, 2016 [DOI: 10.1016/j.surfcoat.2016.07.089] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Bastürk, Serhan Klocke, Fritz Mattfeld, Patrick-Marcel Trauth, Daniel Hild, Rafael (Corresponding author) |
[Journal Article] Influence of Boron Content on Microstructure and Properties of Wire-arc Sprayed Fe-based Coatings In: Thermal spray bulletin, 9 (1), 60-68, 2016 | Yao, Haihua Zhou, Zheng Wang, Yiming He, Ding-Young Bobzin, Kirsten Zhao, Lidong Öte, Mehmet Linke, Thomas Frederik Königstein, Tim Denis Stefan |
[Journal Article] Thermisch gespritzte Korrosionsschutzschichten, eine Ergänzung zur Feuerverzinkung! In: WOMag : Kompetenz in Werkstoff und funktioneller Oberfläche, 5 (6), 41, 2016 [DOI: 10.7395/2016/Knoch01] | Bobzin, Kirsten Öte, Mehmet Schulz, Christiane Knoch, Martin Andreas |
[Journal Article] Tribologisches Verhalten von eisenbasierten Titankarbid verstärkten thermisch gespritzten Schichten In: Tribologie und Schmierungstechnik, 5, 19-24, 2016 | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Malik, Katarzyna Königstein, Tim Denis Stefan |
[Journal Article] Process Development for Innovative Iron Alloy Metallic Glass Coatings In: Advanced engineering materials, 18 (10), 1833-1840, 2016 [DOI: 10.1002/adem.201600177] | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Königstein, Tim Denis Stefan (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Effect of long-term heat-treatment at 1150°C on the microstructure and properties of thermal barrier coatings based on ZrO2-4mol.% Y2O3-1mol.% Gd2O3-1mol.% Yb2O3 In: Surface and coatings technology, 318, 142-146, 2016 [DOI: 10.1016/j.surfcoat.2016.06.055] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Öte, Mehmet Königstein, Tim Denis Stefan |
[Journal Article] Investigation of Reactive HPPMS Process and Influence of Bias Voltage during Deposition of Alumina Coatings In: Advanced engineering materials, 18 (4), 665-670, 2016 [DOI: 10.1002/adem.201500417] | Bobzin, Kirsten Brögelmann, Tobias Brugnara, Ricardo H. Bastürk, Serhan (Corresponding author) Bagcivan, Nazlim |
[Journal Article] Influence of HPPMS pulse parameters on the reactive gas N2 and on the properties of (Cr, Al)N coatings In: Surface and coatings technology, 293, 28-34, 2015 [DOI: 10.1016/j.surfcoat.2015.12.072] | Bobzin, Kirsten Brögelmann, Tobias Brugnara, Ricardo H. Kruppe, Nathan Christopher (Corresponding author) Chromy, Stephan |
[Journal Article] Modelling the Plasma Jet in Multi-Arc Plasma Spraying In: Journal of thermal spray technology : JTST, 25 (6), 1111-1126, 2016 [DOI: 10.1007/s11666-016-0438-0] | Bobzin, Kirsten Öte, Mehmet (Corresponding author) Schein, J. Zimmermann, Stephan Möhwald, K. Lummer, C. |
[Journal Article] Drei Mikrometer Hightech - Einsatz von PVD-Beschichtungen zur Verbesserung des Extrusionsprozesses In: Kunststoffe, 106 (7), 62-65, 2016 | Hopmann, Christian Höfs, Christopher Frederic (Corresponding author) Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Naderi, Mona |
[Contribution to a conference proceedings, Journal Article] Minimizing Frictional Losses in Crankshaft Bearings of Automobile Powertrain by Diamond-like Carbon Coatings under Elasto-hydrodynamic Lubrication In: Surface and coatings technology, 290, 100-109, 2016 [DOI: 10.1016/j.surfcoat.2015.08.064] | Bobzin, Kirsten Brögelmann, Tobias (Corresponding author) |
[Journal Article] Verformungsverhalten nanostrukturierter HPPMS-Hartstoffschichten In: Vakuum in Forschung und Praxis, 28 (3), 18-25, 2016 [DOI: 10.1002/vipr.201600604] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa (Corresponding author) |
[Journal Article] Thermische Auslagerung eines mehrlagigen Oxidationsschutz-Beschichtungssystems für γ-Titaniumaluminide In: Thermal spray bulletin, 9 (1), 34-40, 2016 | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik |
[Journal Article] HPPMS (Cr1-xAlx)N+WSy Coatings for the Application in Dry Cold Forging of Steel: Synthesis and Raman Characterization In: Dry metal forming open access journal, 2, 72-77, 2016 [DOI: 10.18154/RWTH-2016-04878] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa Bastürk, Serhan (Corresponding author) Klocke, Fritz Mattfeld, Patrick Trauth, Daniel Hild, Rafael |
[Journal Article] Recommendations for Dry Forming of 16MnCr5 and 42CrMo4 in Cold Forging In: Dry metal forming open access journal, 2, 44-49, 2016 [DOI: 10.18154/RWTH-2016-04874] | Klocke, Fritz Hild, Rafael (Corresponding author) Trauth, Daniel Mattfeld, Patrick Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher |
[Journal Article] Influence of the Composition on the Properties of (Cr 1-x Al x )N/Mo y S z PVD Coatings In: Advanced engineering materials, 18 (6), 1036-1043, 2016 [DOI: 10.1002/adem.201500499] | Bobzin, Kirsten Brögelmann, Tobias Bastürk, Serhan (Corresponding author) Klocke, Fritz Mattfeld, Patrick Trauth, Daniel Polcik, Peter Kolozsvári, Szilárd |
[Journal Article] In-Mould-Metal-Spraying - Surface and partial metallisation of plastic parts In: European tool & mould making : ETMM, 18 (5), 38-39, 2016 | Hopmann, Christian Bobzin, Kirsten Ochotta, Philipp (Corresponding author) Öte, Mehmet Knoch, Martin Andreas Liao, Xifang |
[Journal Article] Modeling Multi-arc Spraying Systems In: Journal of thermal spray technology, 25 (5), 920-932, 2016 [DOI: 10.1007/s11666-016-0407-7] | Bobzin, Kirsten Öte, Mehmet (Corresponding author) |
[Journal Article] Improved molding of micro structures using PVD-coated mold inserts In: Journal of Polymer Engineering, 36 (6), 575-582, 2015 [DOI: 10.1515/polyeng-2015-0270] | Hopmann, Christian Bobzin, Kirsten Brögelmann, Tobias Schäfer, Christian Schöngart, Maximilian Röbig, Malte (Corresponding author) Naderi, Mona |
[Journal Article] Wear and Corrosion Resistance of Fe-Based Coatings Reinforced by TiC Particles for Application in Hydraulic Systems In: Journal of thermal spray technology, 25 (1), 365-374, 2015 [DOI: 10.1007/s11666-015-0316-1] | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik (Corresponding author) Malik, Katarzyna |
[Journal Article] Influence of Process Parameter on Grit Blasting as a Pretreatment Process for Thermal Spraying In: Journal of thermal spray technology, 25 (1), 3-11, 2015 [DOI: 10.1007/s11666-015-0297-0] | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Sommer, Jan Liao, Xifang (Corresponding author) |
[Journal Article] IMKS and IMMS : two methods for the production of plastic parts featuring metallic areas In: Journal of polymer engineering, 36 (6), 549-556, 2015 [DOI: 10.1515/polyeng-2014-0281] | Hopmann, Christian Bobzin, Kirsten Schoeldgen, Roman Öte, Mehmet Wunderle, Johannes Linke, Thomas F. Ochotta, Philipp (Corresponding author) |
[Journal Article] In-Mould-Metal-Spraying - Neuer Verfahrensansatz zur Metallisierung von Kunststoffbauteilen In: Werkstoffe in der Fertigung, 52 (2), 16-17, 2015 | Hopmann, Christian Bobzin, Kirsten Ochotta, Philipp Öte, Mehmet Linke, Thomas Frederik Liao, Xifang |
[Journal Article] Aluminum-rich HPPMS (Cr1−xAlx)N coatings deposited with different target compositions and at various pulse lengths In: Vacuum : surface engineering, surface instrumentation & vacuum technology, 122 (Part A), 201-207, 2015 [DOI: 10.1016/j.vacuum.2015.09.028] | Bobzin, Kirsten Brögelmann, Tobias Brugnara, R. H. (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] CrN/AlN and CrN/AlN/Al2O3 coatings deposited by pulsed cathodic arc for aluminum die casting applications In: Surface and coatings technology, 284, 222-229, 2015 [DOI: 10.1016/j.surfcoat.2015.07.074] | Bobzin, Kirsten Brögelmann, Tobias Brugnara, R. H. Kruppe, Nathan Christopher (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Analysis of ion energy distribution at the substrate during a HPPMS (Cr,Al)N process using retarding field energy analyzer and energy resolved mass spectrometer In: Thin solid films, 596, 140-146, 2015 [DOI: 10.1016/j.tsf.2015.08.059] | Bobzin, Kirsten Brögelmann, Tobias Brugnara, Ricardo H. Chromy, S. (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Investigation on Plastic Behavior of HPPMS CrN, AIN and CrN/AIN-Multilayer Coatings using Finite Element Simulation and Nanoindentation In: Surface and coatings technology, 284, 310-317, 2015 [DOI: 10.1016/j.surfcoat.2015.07.081] | Bobzin, Kirsten Brögelmann, Tobias Brugnara, Ricardo H. Arghavani, Mostafa (Corresponding author) Yang, T.-S. Chang, Y.-Y. Chang, S.-Y. |
[Journal Article] Metallisierung von Kunststoffoberflächen - ein neues Verfahren: "In-Mould Metal Spraying (IMMS)" In: Jahrbuch Oberflächentechnik, 71, 68-73, 2015 | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Liao, Xifang Hopmann, Christian Ochotta, Philipp (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Influence of wetting and thermophysical properties of diamond-like carbon coatings on the frictional behavior in automobile gearboxes under elasto-hydrodynamic lubrication In: Surface and coatings technology, 248, 290-301, 2015 [DOI: 10.1016/j.surfcoat.2015.06.087] | Bobzin, Kirsten Brögelmann, Tobias (Corresponding author) Stahl, Karsten Stemplinger, Johann-Paul Mayer, Josef Hinterstoißer, M. |
[Journal Article] Application of thermal spraying for the manufacture of metal/plastic components In: Thermal Spray Bulletin, 8 (1), 2-5, 2015 | Bobzin, Kirsten Liao, Xifang Linke, Thomas Frederik Öte, Mehmet Hopmann, Christian Ochotta, Philipp |
[Journal Article] Numerical Analysis of the Tribological Mode of Action in Cold Forming of Sinus Waved Surface Structures In: Dry metal forming open access journal, 1, 137-142, 2015 | Klocke, Fritz Trauth, Daniel Hild, Rafael (Corresponding author) Mattfeld, Patrick Bobzin, Kirsten Brögelmann, Tobias Bastürk, Serhan |
[Journal Article] Tribological Behavior of (Cr1-xAlc)N/WSy PVD Tool Coatings for the Application in Dry Cold Forging of Steel In: Dry metal forming open access journal, 1, 152-158, 2015 | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Bastürk, Serhan (Corresponding author) Klocke, Fritz Mattfeld, Patrick Trauth, Daniel |
[Journal Article] Metallisierung von Kunststoffoberflächen - ein neues Verfahren: "In-Mould Metal Spraying (IMMS)" In: Jahrbuch Oberflächentechnik, 71, 67-73, 2015 | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Liao, Xifang Hopmann, Christian Ochotta, P. |
[Journal Article] Iron-based, titanium-carbide-reinforced thermally sprayed coatings for hydraulic systems In: Thermal spray bulletin, 8 (2), 148-155, 2015 | Bobzin, Kirsten (Corresponding author) Öte, Mehmet (Corresponding author) Linke, Frederik (Corresponding author) Malik, Katarzyna |
[Journal Article] A Numerical Investigation : Air Plasma Spraying by Means of a Three-Cathode Spraying Torch In: Thermal spray bulletin, 8 (2), 118-125, 2015 | Bobzin, Kirsten Öte, Mehmet |
[Journal Article] Hochleistungsplasmen zur Synthese diamantähnlicher Kohlenstoffschichten : Einfluss verschiedener Prozessgase und HPPMS-Pulsparameter auf die Plasmaeigenschaften In: Vakuum in Forschung und Praxis, 27 (5), 22-28, 2015 [DOI: 10.1002/vipr.201500591] | Bobzin, Kirsten Brögelmann, Tobias Bastürk, Serhan Engels, Martin Gottfried (Corresponding author) |
[Journal Article] Impulse geben : Kooperation für innovative Entwicklungen ; IOT und CemeCon In: Facts / Deutsche Ausgabe, 41 (Juli), 9-10, 2015 | Bobzin, Kirsten Brögelmann, Tobias Bastürk, Serhan |
[Journal Article] Laserunterstütztes Drehen von thermisch gespritzten WC-10Co-4Cr-Verschleißschutzschichten In: Thermal spray bulletin, 8 (1), 43-49, 2015 | Bobzin, Kirsten (Corresponding author) Zhao, Lidong (Corresponding author) Öte, Mehmet (Corresponding author) Linke, Thomas Frederik (Corresponding author) Klocke, Fritz Gräfe, Stefan (Corresponding author) Arntz, Kristian (Corresponding author) Brummer, Christoph |
[Journal Article] Influence of surface treatment on the bond strength of plastics/metal hybrids In: Zeitschrift Kunststofftechnik, 7, 228-255, 2015 | Hopmann, Christian Wunderle, Johannes Neuß, Andreas Ochotta, Philipp Bobzin, Kirsten Schulz, Christiane Liao, Xifang |
[Journal Article] Wear behaviour of hydrogenated DLC in a pin-on-disc model test under lubrication with different diesel fuel types In: Tribology international, 92, 12-20, 2015 [DOI: 10.1016/j.triboint.2015.05.020] | Djoufack, Martin H. (Corresponding author) May, U. Repphun, G. Brögelmann, Tobias Bobzin, Kirsten |
[Journal Article] Anwendungen des Thermischen Spritzens für die Herstellung von Metall-Kunststoff-Bauteilen In: Thermal spray bulletin, 8, 28-31, 2015 | Bobzin, Kirsten (Corresponding author) Öte, Mehmet Linke, Thomas Frederik Liao, Xifang Hopmann, Christian Ochotta, Philipp |
[Journal Article] Multiscale FE-Studies of Contact Stresses of Dry and Lubricated Shot Peened Workpiece Surfaces In: Dry metal forming open access journal, 1, 11-16, 2015 | Klocke, Fritz Trauth, Daniel (Corresponding author) Mattfeld, Patrick Shirobokov, Anton Bobzin, Kirsten Brögelmann, Tobias Bastürk, Serhan |
[Journal Article] Development of an in situ Plasma Treatment of X155CrMoV12 for a (Cr,Al)N PVD Tool Coating for Dry Metal Forming in Cold Forging In: Dry metal forming open access journal, 1, 57-62, 2015 | Bobzin, Kirsten Brögelmann, Tobias Bastürk, Serhan (Corresponding author) Klocke, Fritz Mattfeld, Patrick Trauth, Daniel |
[Journal Article] Friction reduction of highly-loaded rolling-sliding contacts by surface modifications under elasto-hydrodynamic lubrication In: Wear, 328/329, 217-228, 2015 [DOI: 10.1016/j.wear.2015.02.033] | Bobzin, Kirsten Brögelmann, Tobias (Corresponding author) Stahl, K. Michaelis, K. Mayer, J. Hinterstoißer, M. |
[Contribution to a conference proceedings, Journal Article] Deposition and characterization of thermal barrier coatings of ZrO2-4 mol.% Y2O3-1 mol.% Gd2O3-1 mol.% Yb2O3 In: Surface and coatings technology, 268, 205-208, 2014 [DOI: 10.1016/j.surfcoat.2014.05.051] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Öte, Mehmet Linke, Thomas Frederik |
[Journal Article] Preparation of spherical calcium phosphate granulates suitable for the biofunctionalization of active brazed titanium alloy coatings In: Biomedizinische Technik = Biomedical engineering, 60 (2), 105-114, 2014 [DOI: 10.1515/bmt-2014-0017] | Schickle, Karolina Gerardo-Nava, Jose L. (Corresponding author) Puidokas, Sabrina Michelle Samadian Anavar, Sharareh Bergmann, Christian Gingter, Philipp Schickle, Benjamin Bobzin, Kirsten Fischer, Horst |
[Journal Article] Corrosion of Wire Arc Sprayed ZnMgAl In: Materials and corrosion = Werkstoffe und Korrosion, 66 (6), 520-526, 2015 [DOI: 10.1002/maco.201407601] | Bobzin, Kirsten Öte, Mehmet Linke, T. F. Schulz, Christiane (Corresponding author) |
[Journal Article] Experimental and simulative strain field investigation of nano- and microscratches on nanolaminated (Cr, Al)N coating In: Thin solid films, 573, 33-40, 2014 [DOI: 10.1016/j.tsf.2014.10.095] | Perne, Jan (Corresponding author) |
[Journal Article] Strukturen im Mikro-Format : Oberflächenstrukturen an PVD-Beschichteten Werkzeugeinsätze In: Form + Werkzeug, Juni 2014, 65-65, 2014 | Hopmann, Christian (Corresponding author) Bobzin, Kirsten Bagcivan, Nazlim Brögelmann, Tobias Schäfer, Christian Schöngart, Maximilian |
[Contribution to a conference proceedings, Journal Article] Development of (Cr,Al)ON coatings using middle frequency magnetron sputtering and investigations on tribological behavior against polymers In: Surface and coatings technology, 260, 347-361, 2014 [DOI: 10.1016/j.surfcoat.2014.09.016] | Bagcivan, Nazlim Bobzin, Kirsten Brögelmann, Tobias (Corresponding author) Kalscheuer, Christian |
[Contribution to a conference proceedings, Journal Article] CrN/AlN nanolaminate coatings deposited via high power pulsed and middle frequency pulsed magnetron sputtering In: Thin solid films, 572, 153-160, 2014 [DOI: 10.1016/j.tsf.2014.06.058] | Bagcivan, N. Bobzin, Kirsten Ludwig, A. Grochla, D. Brugnara, R. H. (Corresponding author) |
[Contribution to a book, Journal Article] Characterization of Reactive Air Brazed Ceramic/Metal Joints with Unadapted Thermal Expansion Behavior In: Advanced engineering materials, 16 (12), 1490-1497, 2014 [DOI: 10.1002/adem.201400311] | Bobzin, Kirsten Öte, Mehmet Wiesner, Stefanie (Corresponding author) Kaletsch, Anke Broeckmann, Christoph |
[Contribution to a book, Journal Article] Influence of Filler and Base Material on the Pore Development during Reactive Air Brazing In: Advanced engineering materials, 16 (12), 1456-1461, 2014 [DOI: 10.1002/adem.201400177] | Bobzin, Kirsten Kopp, Nils Wiesner, Stefanie (Corresponding author) |
[Journal Article] Tribological Evaluation of Hydrogenated DLC in Diesel Lubricated Diesel Model Test In: Surface & coatings technology, 258, 381-391, 2014 [DOI: 10.1016/j.surfcoat.2014.08.065] | Djoufack, Martin (Corresponding author) May, Ulrich Bagcivan, Nazlim Brögelmann, Tobias Bobzin, Kirsten |
[Contribution to a book, Journal Article] Comparison of (Ti,Al)N and (Ti,Al)N/gamma-Al2O3 coatings regarding tribological behavior and machining performance In: Surface & coatings technology, 257, 58-62, 2014 [DOI: 10.1016/j.surfcoat.2014.08.070] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, M. Brugnara, R. H. Bastürk, Serhan (Corresponding author) |
[Journal Article] High temperature corrosion behaviour of wire arc sprayed Fe based coatings In: Surface engineering, 30 (8), 573-578, 2014 [DOI: 10.1179/1743294414Y.0000000287] | Li, R. (Corresponding author) He, D. Y. Zhou, Z. Zhao, Lidong Song, X. Y. |
[Journal Article] Microstructure behaviour and influence on thermally grown oxide formation of double-ceramic-layer EB-PVD thermal barrier coatings annealed at 1,300 °C under ambient isothermal conditions In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 45 (10), 879-893, 2014 [DOI: 10.1002/mawe.201400248] | Bobzin, Kirsten Bagcivan, Nazlim Brögelmann, Tobias Yildirim, Baycan (Corresponding author) |
[Journal Article] Investigations of laser clad, thermal sprayed and laser remelted AlSi20-coatings on magnesium alloy AZ31B under constant and cycling thermal load In: Surface & coatings technology, 259 (Pt. C), 751-758, 2014 [DOI: 10.1016/j.surfcoat.2014.09.049] | Rolink, Gesa (Corresponding author) Weisheit, Andreas Biermann, Tim Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Schulz, Christiane Kelbassa, Ingomar |
[Journal Article] Einfluss der Wärmebehandlung auf Mikrostruktur und thermophysikalische Eigenschaften von Plasma gespritzten ZrO2-7%Y2O3- und La2Zr2O7-Schichten In: Thermal spray bulletin, 7 (1), 43-49, 2014 | Bobzin, Kirsten Linke, Thomas Frederik Zhao, Lidong Erdogan, Garip Üstel, Fatih Öte, Mehmet |
[Journal Article] Emissions in Thermal Spraying : Development of a Suitable Test Method and Evaluation of Measurements in Laboratory as well as in Industrial Scale In: Thermal spray bulletin, 7 (2), 136-141, 2014 | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Dott, Wolfgang Möller, Manfred |
[Journal Article] Erforschung Ti-Co-basierter, bioaktiver Auftraglötschichten auf oxidischen Hochleistungskeramiken in der Medizintechnik In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 45 (6), 504-511, 2014 [DOI: 10.1002/mawe.201400268] | Bobzin, Kirsten Kopp, Nils Wiesner, Stefanie Puidokas, Sabrina Michelle Samadian Anavar, Sharareh (Corresponding author) Fischer, Horst Korsten, Anne Schickle, Karolina |
[Journal Article] Microstructure and high-temperature oxidation behavior of wire-arc sprayed Fe-based coatings In: Surface & coatings technology, 251, 186-190, 2014 [DOI: 10.1016/j.surfcoat.2014.04.024] | Li, Ran (Corresponding author) Zhou, Zheng He, Dingyong Zhao, Lidong Song, Xiaoyan |
[Contribution to a book, Journal Article] Correlation between Chemical Glass Components and the Glass Sticking on Sputtered PtIr Physical Vapour Deposition Coatings for Precision Blank Moulding In: Materials Sciences and Applications : MSA, 5, 316-329, 2014 [DOI: 10.4236/msa.2014.55037] | Bobzin, Kirsten Bagcivan, Nazlim Brögelmann, Tobias Münstermann, Tobias |
[Journal Article] Plastic flow behavior of (Cr, Al) N hard coatings in dependence of strain rate and nanostructure In: Thin solid films, 556, 390-394, 2014 [DOI: 10.1016/j.tsf.2014.01.069] | Perne, Jan (Corresponding author) |
[Journal Article] Influence of Ar/Kr ratio and pulse parameters in a Cr-N high power pulse magnetron sputtering process on plasma and coating properties In: Journal of vacuum science & technology / A, Vacuum, surfaces, & films, 32 (2), 021513, 2014 [DOI: 10.1116/1.4865917] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Trieschmann, Jan Brugnara, Ricardo H. (Corresponding author) Preissing, Sven Hecimovic, Ante |
[Journal Article] Wide Gap Active Brazing of Ceramic-to-Metal-Joints for High Temperature Applications In: Frontiers of mechanical engineering in China, 9 (1), 71-74, 2014 [DOI: 10.1007/s11465-014-0291-0] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Kopp, Nils Samadian Anavar, Sharareh |
[Journal Article] Systematische Untersuchung der Eigenschaften gelöteter Fügeverbunde mit anwendungsrelevanten Prüfverfahren In: Schweißen und Schneiden, 65 (5), 254-261, 2013 | Bobzin, Kirsten Kopp, Nils Puidokas, Sabrina Michelle Tillmann, Wolfgang Wojarski, Lukas Liu, C. Manka, Matthias |
[Journal Article] Einsatz von PVD-Beschichtungen zur Verschleißreduzierung im tribologischen System Pumpe In: Tribologie und Schmierungstechnik, 61, 5-13, 2013 | Bobzin, Kirsten (Corresponding author) Bagcivan, Nazlim Brögelmann, Tobias Sauter, K. Wegener, T. |
[Journal Article] Einfluss von Lot- und Grundwerkstoffen auf die Porosität mittels "Reactive Air Brazing" gelöteter Keramik-Keramik- und Keramik-Metall-Verbindungen In: Schweissen und Schneiden, 65 (12), 838-842, 2013 | Bobzin, Kirsten Kopp, Nils Wiesner, Stefanie |
[Journal Article] Wear and high-temperature corrosion behavior of a wire-arc sprayed NiCrB coating In: Thermal spray bulletin, 2013 (1), 48, 2013 | Zhou, Z. Bobzin, Kirsten He, D. Y. Zhao, Lidong Zhao, X. Z. Kopp, Nils Zhao, Q. Y. Li, R. S. |
[Journal Article] Surface chemistry of PVD (Cr,Al)N coatings deposited by means of direct current and high power pulsed magnetron sputtering In: Surface and interface analysis : Sia, 45 (13), 1884-1892, 2013 [DOI: 10.1002/sia.5336] | Kunze, Christian Brugnara, Ricardo H. Bagcivan, Nazlim Bobzin, Kirsten Grundmeier, Guido (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Influence of temperature on phase stability and thermal conductivity of single- and double-ceramic-layer EB-PVD TBC top coats consisting of 7YSZ, Gd2Zr2O7 and La2Zr2O7 In: Surface & coatings technology, 237, 56-64, 2013 [DOI: 10.1016/j.surfcoat.2013.08.013] | Bobzin, Kirsten Bagcivan, Nazlim Brögelmann, Tobias Yildirim, Baycan (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Continuum and kinetic simulations of the neutral gas flow in an industrial physical vapor deposition reactor In: Surface & coatings technology, 237, 176-181, 2013 [DOI: 10.1016/j.surfcoat.2013.08.018] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Brugnara, Ricardo H. Schäfer, Marcel Pascal Brinkmann, Ralf Peter Mussenbrock, Thomas Trieschmann, Jan (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Influence of Application Technology on the Erosion Resistance of DLC coatings In: Surface & coatings technology, 237, 284-291, 2013 [DOI: 10.1016/j.surfcoat.2013.07.043] | Depner-Miller, U. (Corresponding author) Ellermeier, J. Scheerer, H. Oechsner, Matthias Bobzin, Kirsten Bagcivan, Nazlim Brögelmann, Tobias Weiss, R. Durst, K. Schmid, C. |
[Contribution to a conference proceedings, Journal Article] Influence of HPPMS pulse length and inert gas mixture on the properties of (Cr,Al)N coatings In: Thin solid films, 549, 192-198, 2013 [DOI: 10.1016/j.tsf.2013.06.036] | Bagcivan, Nazlim Bobzin, Kirsten Grundmeier, G. Wiesing, M. Ozcan, O. Kunze, C. Brugnara, Ricardo H. (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Flow curve determination of thin films by improved finite element models and different nanoindenter geometries In: Thin solid films, 549, 313-320, 2013 [DOI: 10.1016/j.tsf.2013.06.037] | Bobzin, Kirsten Bagcivan, N. Brugnara, R. H. Perne, J. (Corresponding author) |
[Contribution to a book, Journal Article] Vereinfachte Berechnung der Mikrostruktur zur Ableitung der Schichteigenschaften im thermischen Spritzen In: Jahrbuch Oberflächentechnik, 69, 139-154, 2013 | Bobzin, Kirsten Kopp, Nils Linke, Thomas Frederik Schäfer, Marcel Pascal |
[Contribution to a conference proceedings, Journal Article] Investigation of the Properties of Low Temperature (Cr1-xAlx)N Coatings Deposited via Hybrid PVD DC-MSIP/HPPMS In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (8), 667-672, 2013 [DOI: 10.1002/mawe.201300173] | Bobzin, Kirsten Bagcivan, Nazlim Brugnara, Ricardo H. (Corresponding author) |
[Journal Article] Approach to determine stress strain curves by FEM supported nanoindentation In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (6), 571-576, 2013 [DOI: 10.1002/mawe.201300099] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Brugnara, Ricardo H. Perne, Jan (Corresponding author) |
[Journal Article] Thermal stability of silicon-doped Al2O3 PVD coatings In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (8), 679-683, 2013 [DOI: 10.1002/mawe.201300175] | Bobzin, Kirsten Bagcivan, Nazlim Müller, M. Ewering, Mara Therese Brugnara, Ricardo H. (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Development and qualification of a MSIP PVD iridium coating for precision glass moulding In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (8), 673-678, 2013 [DOI: 10.1002/mawe.201300174] | Bobzin, Kirsten Bagcivan, Nazlim Brögelmann, Tobias Münstermann, Tobias (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Improvement of Coating Properties in Three-Cathode Atmospheric Plasma Spraying In: Journal of thermal spray technology : JTST, 22 (4), 502-508, 2013 [DOI: 10.1007/s11666-013-9902-2] | Bobzin, Kirsten Kopp, Nils Warda, Thomas Petkovic, Ivica Zimmermann, S. (Corresponding author) Hartz-Behrend, K. Landes, K. Forster, G. Kirner, S. Marqués, J.-L. Schein, J. Prehm, J. (Corresponding author) Möhwald, K. Bach, Fr.-W. |
[Journal Article] Synthesis of nano-structured HPPMS CrN/AlN coatings In: Journal of physics / D, Applied physics, 46 (8), 084001, 2013 [DOI: 10.1088/0022-3727/46/8/084001] | Bagcivan, Nazlim Bobzin, Kirsten Theiß, Sebastian |
[Journal Article] Flow curve determination on dc-MS and HPPMS CrAlN coatings In: Journal of physics / D, Applied physics, 46 (8), 084006, 2013 [DOI: 10.1088/0022-3727/46/8/084006] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Perne, Jan (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Particle In-Flight and Coating Properties of Fe-Based Feedstock Materials Sprayed with Modern Thermal Spray Systems In: Journal of thermal spray technology : JTST, 22 (2/3), 363-370, 2013 [DOI: 10.1007/s11666-012-9853-z] | Bobzin, Kirsten Kopp, Nils Warda, Thomas (Corresponding author) Petkovic, Ivica Schaefer, Marcel Landes, Klaus Forster, Günter Zimmermann, Stephan Marques, Jose-Luis Kirner, Stefan Kauffeldt, Marina Schein, Jochen |
[Contribution to a conference proceedings, Journal Article] (Cr1-xAlx)N : A comparison of direct current, middle frequency pulsed and high power pulsed magnetron sputtering for injection molding components In: Thin solid films, 528, 180-186, 2013 [DOI: 10.1016/j.tsf.2012.08.056] | Bagcivan, Nazlim Bobzin, Kirsten Theiß, Sebastian (Corresponding author) |
[Contribution to a conference proceedings, Journal Article] Behavior of DLC coated low-alloy steel under tribological and corrosive load : Effect of top layer and interlayer variation In: Surface & coatings technology, 215, 110-118, 2013 [DOI: 10.1016/j.surfcoat.2012.08.075] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Weiß, Raphael (Corresponding author) Depner, Udo Trossmann, Torsten Ellermeier, Jörg Oechsner, Matthias |
[Journal Article] Stellenwert des Plasmaspritzens unter den thermischen Spritzverfahren In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 103 (11), 2384-2395, 2012 | Bobzin, Kirsten Warda, Thomas Brühl, Markus |
[Journal Article] Improving Contour Accuracy and Strength of Reactive Air Brazed (RAB) Ceramic/Metal Joints by Controlling Interface Microstructure In: Advanced engineering materials, 14 (6), 394-399, 2012 [DOI: 10.1002/adem.201100274] | Li, Chichi Kuhn, Bernd Brandenberg, Jörg Beck, Tilmann Singheiser, Lorenz Bobzin, Kirsten Bagcivan, Nazlim Kopp, Nils |
[Journal Article] Feasibility study of plasma sprayed Al2O3 coatings as diffusion barrier on CFC components In: Frontiers of Mechanical Engineering, 7 (4), 371-375, 2012 [DOI: 10.1007/s11465-012-0339-y] | Bobzin, Kirsten Zhao, Lidong Kopp, Nils Warda, Thomas |
[Journal Article] Thermisch gespritzte Korrosionsschutzschichten auf Zink-Basis als Ergänzung zum Stückverzinken von Bauteilen In: Thermal spray bulletin, 5 (1), 48-55, 2012 | Bobzin, Kirsten Kopp, Nils Warda, Thomas Schulz, Christiane Klesen, Christian Poller, Benjamin Ingendahl, Tobias |
[Journal Article] Determination of the Effective Properties of Thermal Spray Coatings Using 2D and 3D Models In: Journal of thermal spray technology : JTST, 21 (6), 1269-1277, 2012 [DOI: 10.1007/s11666-012-9809-3] | Bobzin, Kirsten Kopp, Nils Warda, Thomas Öte, Mehmet |
[Journal Article] Extrusion embossing of hydrophobic films - a study on process characteristics and surface properties In: Zeitschrift Kunststofftechnik = Journal of plastics technology, 8 (3), 302-330, 2012 | Hopmann, Christian Michaeli, Walter Eilbracht, Stephan Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Hartmann, Claudia Holtkamp, Jens Gillner, Arnold Mayer, Joachim |
[Journal Article] Investigation of wear and corrosion protection of AlSi20 coatings produced by thermal spraying and laser cladding on AZ31B In: Journal of thermal spray technology : JTST, 22 (2/3), 207-212, 2012 [DOI: 10.1007/s11666-012-9867-6] | Bobzin, Kirsten Kopp, Nils Warda, Thomas Schulz, Christiane (Corresponding author) Rolink, Gesa Weisheit, Andreas |
[Contribution to a conference proceedings, Journal Article] Comparison of (Cr0.75Al0.25)N Coatings Deposited by Conventional and High Power Pulsed Magnetron Sputtering In: Contributions to plasma physics : CPP, 52 (7), 601-606, 2012 [DOI: 10.1002/ctpp.201210056] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian |
[Journal Article] Influence of interlayer thickness of a thin noble metal MSIP-PVD coating on compound and system properties for glass lens moulding In: Production engineering, 6 (3), 311-318, 2012 [DOI: 10.1007/s11740-012-0385-7] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Brugnara, Ricardo H. Münstermann, Tobias |
[Journal Article] Vanadium Alloyed PVD CrAlN Coatings for Friction Reduction in Metal Forming Applications In: Tribology in Industry, 34 (2), 101-107, 2012 | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Brugnara, Ricardo H. |
[Journal Article] Influence of the Layer Architecture of DLC Coatings on their Wear and Corrosion Resistance In: International journal of materials research : IJMR, 103 (6), 774-782, 2012 [DOI: 10.3139/146.110763] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Weiß, Raphael Troßmann, Torsten Ellermeier, Jörg Oechsner, Matthias Depner, Udo |
[Journal Article] Kraftstoffersparnis durch Hochleistungswerkstoffe In: Vakuum in Forschung und Praxis : VIP, 24 (2), 35-38, 2012 [DOI: 10.1002/vipr.201200487] | Bobzin, Kirsten Bagcivan, Nazlim Verpoort, Clemens Schramm, Leander Yilmaz, Koray Theiß, Sebastian (Corresponding author) |
[Journal Article] Development of an integrative simulation method to predict the microstructural influence on the mechanical behaviour of semi-crystalline thermoplastic parts In: International journal of materials research : IJMR, 103 (1), 120-130, 2012 [DOI: 10.3139/146.110628] | Michaeli, Walter Hopmann, Christian Bobzin, Kirsten Arping, Tim Wilhelm Baranowski, Thomas Heesel, Barbara Laschet, Gottfried Schläfer, Thomas Öte, Mehmet |
[Journal Article] Application of variothermal heating concepts for the production of micro-structured films using the extrusion embossing process In: Journal of polymer engineering, 32 (2), 95-101, 2012 [DOI: 10.1515/polyeng-2012-0502] | Michaeli, Walter Eilbracht, Stephan Scharf, Micha Christian Hartmann, Claudia Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian |
[Journal Article] Ultrasonic welding of hybrid metal-plastic components with flame spraying of adhesion layer In: Zeitschrift Kunststofftechnik, 7, 161-177, 2011 | Flock, Dustin (Corresponding author) Haberstroh, Edmund Bobzin, Kirsten Schläfer, Thomas Warda, Thomas Kutschmann, Pia |
[Journal Article] Development of oxide based diffusion barrier coatings for CFC components applied in modern furnaces In: Frontiers of Mechanical Engineering, 6 (4), 392-396, 2011 [DOI: 10.1007/s11465-011-0241-z] | Bobzin, Kirsten Zhao, Lidong Schläfer, Thomas Warda, Thomas |
[Journal Article] HPPMS coatings for metal deformation tools In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 102 (5), 1150-1157, 2011 | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Brugnara, Ricardo H. |
[Journal Article] Preparation and characterization of nanocrystalline ZrO2-7%Y2O3 powders for thermal barrier coatings by high-energy ball milling In: Frontiers of Mechanical Engineering, 6 (2), 176-181, 2011 [DOI: 10.1007/s11465-011-0220-4] | Bobzin, Kirsten Zhao, Lidong Schläfer, Thomas Warda, Thomas |
[Journal Article] Crystalline γ-Al2O3 Physical Vapour Deposition-Coating for Steel Thixoforging Tools In: Journal of nanoscience and nanotechnology, 11 (10), 8782-8785, 2011 [DOI: 10.1166/jnn.2011.3469] | Bobzin, Kirsten Hirt, Gerhard Bagcivan, Nazlim Khizhnyakova, Liudmila Ewering, Mara Therese |
[Journal Article] Improving Long Term Oxidation Protection for Gamma-TiAl Substrates In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 42 (11), 1013-1018, 2011 [DOI: 10.1002/mawe.201100827] | Bobzin, Kirsten Linke, Thomas Frederik Brühl, Markus Warda, Thomas Schläfer, Thomas |
[Journal Article] Optimisation of an HVOF process using simulation techniques In: Thermal spray bulletin, 2, 159-164, 2011 | Bobzin, Kirsten Schläfer, Thomas Schäfer, Marcel Pascal |
[Journal Article] Wear behavior of HPPMS deposited (Ti,Al,Si)N coating under impact loading In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 42 (3), 165-171, 2011 [DOI: 10.1002/mawe.201100771] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Theiß, Sebastian |
[Contribution to a conference proceedings, Journal Article] Hydrogen content variation for enhancing the lubricated tribological performance of DLC coatings with ester In: Surface & coatings technology, 205 (Suppl. 2), 89-93, 2011 [DOI: 10.1016/j.surfcoat.2011.02.065] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Yilmaz, Koray |
[Journal Article] Die Entwicklung des Breitspaltaktivlötens als neue Fügetechnologie für Keramik-Metall-Mischverbunde mit Einsatztemperaturen oberhalb 500 °C In: Keramische Zeitschrift, 63 (5), 329-333, 2011 | Schlegel, Arne Bobzin, Kirsten Kopp, Nils Bagcivan, Nazlim |
[Journal Article] Thermochemistry of brazing ceramics and metals in air In: International journal of materials research : IJMR, 8 (08), 972-976, 2011 [DOI: 10.3139/146.110550] | Bobzin, Kirsten Schläfer, Thomas Kopp, Nils |
[Journal Article] Nachbearbeitungsarme Fe-Basis-Feinstpulverschichtenzum kostengünstigen Korrosionsund Verschleißschutz In: Thermal spray bulletin, 4 (2), 139-146, 2011 | Bobzin, Kirsten Schläfer, Thomas Warda, Thomas Schäfer, Marcel Pascal |
[Journal Article] Injection molding of products with functional surfaces by micro-structured, PVD coated injection molds In: Production engineering, 5 (4), 415-422, 2011 [DOI: 10.1007/s11740-011-0319-9] | Bobzin, Kirsten Bagcivan, Nazlim Gillner, Arnold Hartmann, Claudia Holtkamp, Jens Michaeli, Walter Klaiber, Fritz Schöngart, Maximilian Theiß, Sebastian |
[Journal Article] PVD-beschichteteWälzlager im Trockenlauf In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 42 (11), 1025-1034, 2011 [DOI: 10.1002/mawe.201100847] | Jacobs, Georg Rombach, Volker Plogmann, Michael van Lier, Hermann Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Weiß, Raphael (Corresponding author) |
[Journal Article] In-Vitro Study of Microplasma Sprayed Hydroxyapatite Coatings in Hanks Balanced Salt Solution In: Materials and manufacturing processes, 26 (2), 175-180, 2011 [DOI: 10.1080/10426914.2010.498071] | Zhao, Qiuying He, Dingyong Zhao, Lidong Li, Xiaoyan |
[Journal Article] Replication of specifially microstructured surfaces in A356-alloy via lost wax investment casting In: Journal of micromechanics and microengineering, 21 (8), 085026, 2011 [DOI: 10.1088/0960-1317/21/8/085026] | Ivanov, Todor Bührig-Polaczek, Andreas Vroomen, Uwe Hartmann, Claudia Holtkamp, Jens Gillner, Arnold Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian |
[Journal Article] Numerical and experimental determination of plasma temperature during air plasma spraying with a multiple cathodes torch In: Journal of materials processing technology, 211 (10), 1620-1628, 2011 [DOI: 10.1016/j.jmatprotec.2011.05.001] | Bobzin, Kirsten Bagcivan, Nazlim Petkovic, Ivica |
[Journal Article] Modelling and diagnostics of multiple cathodes plasma torch system for plasma spraying In: Frontiers of Mechanical Engineering, 6 (3), 324-331, 2011 [DOI: 10.1007/s11465-011-0125-2] | Bobzin, Kirsten Bagcivan, Nazlim Zhao, Lidong Petkovic, Ivica Schein, Jochen Hartz-Behrend, Karsten Kirner, Stefan Marqués, José-Luis Forster, Günter |
[Journal Article] DC-MSIP/HPPMS (Cr,Al,V)N and (Cr,Al,W)N thin films for high-temperature friction reduction In: Surface & coatings technology, 205 (8/9), 2887-2892, 2011 [DOI: 10.1016/j.surfcoat.2010.10.056] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Brugnara, Ricardo H. Theiß, Sebastian |
[Journal Article] A Strong Connection of Unequal Partners [Joining method ] In: Kunststoffe / Kunststoffe international, 100 (11), 50-53, 2010 | Flock, Dustin Haberstroh, Edmund Rosner, A. Gillner, Arnold Poprawe, N. R. Theiß, Sebastian Bagcivan, Nazlim Bobzin, Kirsten Wagner, Nikolaus Olschok, Simon Reisgen, Uwe |
[Journal Article] Characterisation of plasma-sprayed SrFe12O19 coatings for electromagnetic wave absorption In: Journal of the European Ceramic Society, 31 (8), 1439-1449, 2010 [DOI: 10.1016/j.jeurceramsoc.2011.02.003] | Bobzin, Kirsten Bolelli, Giovanni Brühl, Markus Hujanen, Arto Lintunen, Pertti Lisjak, Darja Gyergyek, Sašo Lusvarghi, Luca |
[Journal Article] Entwicklung von neuen Aktivlotpulvern auf Basis kommerzieller Nickellote mit Zirkon als Aktivelement zum Fügen von Keramik-Metall-Verbunden In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 41 (6), 455-463, 2010 [DOI: 10.1002/mawe.201000627] | Bobzin, Kirsten Schläfer, Thomas Kopp, Nils Schlegel, Arne |
[Journal Article] Deposition of High-Quality NiCoCrAlTaReSiY Oxidation Resistance Coatings by HVOF In: Xiyou-jinshu-cailiao-yu-gongcheng = Rare metal materials and engineering, 39 (11), 2027-2029, 2010 | Wang, Kaisheng Zhao, Lidong Zhao, Zhimin |
[Journal Article] Systematische Untersuchung der Verbindungseigenschaften von Lötungen mit Ag-, Cu-, Au- und Ni-Basisloten mit anwendungsrelevanten Prüfverfahren In: Schweissen und Schneiden, 62 (5), 256-263, 2010 | Bobzin, Kirsten Schläfer, Thomas Kopp, Nils Puidokas, Sabrina Michelle Tillmann, Walter Osmanda, Artur Martin Wojarski, Lukas |
[Journal Article] Untersuchung und Bewertung der Fehlergrößen im Haftzugversuch nach DIN EN 582 In: Thermal spray bulletin, 3 (1), 30-36, 2010 | Bobzin, Kirsten Schläfer, Thomas Aumund-Kopp, Claus |
[Journal Article] Calculation of effective properties of textile reinforced aluminum alloy by a two-step homogenization procedure In: Computational materials science, 47 (3), 801-806, 2010 [DOI: 10.1016/j.commatsci.2009.11.007] | Bobzin, Kirsten Bagcivan, Nazlim Parkot, Daniel Kashko, Tatyana |
[Journal Article] Hexaferrite/Polyester Composite Coatings for Electromagnetic-Wave Absorbers In: Journal of thermal spray technology : JTST, 20 (3), 638-644, 2010 [DOI: 10.1007/s11666-010-9607-8] | Lisjak, Darja Bégard, Marion Brühl, Markus Bobzin, Kirsten Hujanen, Arto Lintunen, Pertti Bolelli, Giovanni Lusvarghi, Luca Ovtar, Simona Drofenik, Miha |
[Journal Article] HPPMS-Beschichtung für Umformwerkzeuge In: Jahrbuch Oberflächentechnik, 66, 88-95, 2010 | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Brugnara, Ricardo H. |
[Contribution to a book, Contribution to a conference proceedings, Journal Article] Impact Behaviour of PtIr-based Coatings with Different Interlayers for Glass Lens Moulding In: Key engineering materials, 438, 57-64, 2010 [DOI: 10.4028/www.scientific.net/KEM.438.57] | Bobzin, Kirsten Klocke, Fritz Bagcivan, Nazlim Ewering, Mara Therese Georgiadis, Kyriakos Münstermann, Tobias |
[Contribution to a conference proceedings, Journal Article] Thermal stability of [gamma]-Al2O3 coatings for challenging cutting operations In: Surface & coatings technology, 205 (5), 1444-1448, 2010 [DOI: 10.1016/j.surfcoat.2010.07.040] | Bobzin, Kirsten Bagcivan, Nazlim Reinholdt, Alexander Ewering, Mara Therese |
[Contribution to a conference proceedings, Journal Article] Plasma coatings CrAlN and a-C:H for high efficient power train in automobile In: Surface & coatings technology, 205 (5), 1502-1507, 2010 [DOI: 10.1016/j.surfcoat.2010.08.108] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Yilmaz, Koray |
[Journal Article] Hartstoffschichten der Zukunft : Oxidische Schichten und HPPMS-Schichten für anspruchsvolle Zerspanaufgaben In: Vakuum in Forschung und Praxis : VIP, 22 (6), 31-35, 2010 [DOI: 10.1002/vipr.201000437] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese |
[Journal Article] Metal flow and die wear in semi-solid forging of steel using coated dies In: Transactions of Nonferrous Metals Society of China : english edition, 20 (Supplement 3), 954-960, 2010 [DOI: 10.1016/s1003-6326(10)60613-9] | Khizhnyakova, L. Ewering, Mara Therese Hirt, Gerhard Bobzin, Kirsten Bagcivan, Nazlim |
[Journal Article] Influence of the filler materials on flux-free brazing of pure aluminium (1050) In: Frontiers of mechanical engineering in China, 5 (1), 47-51, 2010 [DOI: 10.1007/s11465-009-0079-9] | Bobzin, Kirsten Zhao, Lidong Schläfer, Thomas Warda, Thomas |
[Journal Article] Application of cold spraying for flux-free brazing of aluminium alloy 6060 In: Frontiers of mechanical engineering in China, 5 (3), 256-260, 2010 [DOI: 10.1007/s11465-010-0095-9] | Bobzin, Kirsten Zhao, Lidong Schläfer, Thomas Warda, Thomas |
[Contribution to a conference proceedings, Journal Article] Semi-solid forming of non axis-symmetric parts from steel grade X210CrW12 with PVD coated tools In: International journal of material forming, 3 (1), 731-734, 2010 [DOI: 10.1007/s12289-010-0874-1] | Hirt, Gerhard Bobzin, Kirsten Khizhnyakova, Liudmila Ewering, Mara Therese Bagcivan, Nazlim |
[Contribution to a conference proceedings, Journal Article] Development of Ba-hexaferrite coatings for electromagnetic wave absorption applications In: Surface & coatings technology, 205 (4), 1015-1020, 2010 [DOI: 10.1016/j.surfcoat.2010.03.060] | Bobzin, Kirsten Schläfer, Thomas Bégard, Marion Brühl, Markus Bolelli, Giovanni Lusvarghi, Luca Lisjak, Darja Hujanen, Arto Lintunen, Pertti Kanerva, Ulla Varis, Tommi Pasquale, Massimo |
[Journal Article] Magnetic Phase Formation in CoTi-Substituted Ba Hexaferrite Coatings Prepared with Atmospheric Plasma Spraying In: Journal of the American Ceramic Society, 93 (9), 2579-2584, 2010 [DOI: 10.1111/j.1551-2916.2010.03770.x] | Lisjak, Darja Bolelli, Giovanni Lusvarghi, Luca Bégard, Marion Brühl, Markus Bobzin, Kirsten Lintunen, Pertti Kanerva, Ulla Pasquale, Massimo Drofenik, Miha |
[Journal Article] Starke Verbindung ungleicher Partner In: Kunststoffe / [Deutsche Ausgabe], 11 (112), 60-63, 2010 | Flock, Dustin Haberstroh, Edmund Rösner, Andreas Gillner, Arnold Poprawe, Reinhart Theiß, Sebastian Bagcivan, Nazlim Bobzin, Kirsten Wagner, Nikolaus Olschok, Simon Reisgen, Uwe |
[Journal Article] Development of PVD coatings for application of zinc die casting In: International foundry research, 62 (10), 8-14, 2010 | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese |
[Journal Article] Development of new transient liquid phase system Au-Sn-Au for microsystem technology In: Frontiers of mechanical engineering in China, 5 (4), 370-375, 2010 [DOI: 10.1007/s11465-010-0107-9] | Bobzin, Kirsten Bagcivan, Nazlim Zhao, Lidong Ferrara, Stefania Perne, Jan |
[Journal Article] Brazing of ceramic-to-ceramic and ceramic-to-metal joints in air In: Frontiers of mechanical engineering in China, 5 (2), 125-129, 2010 [DOI: 10.1007/s11465-010-0007-z] | Bobzin, Kirsten Schläfer, Thomas Zhao, Lidong Kopp, Nils Schlegel, Arne |
[Journal Article] Lotus-Effekt für Massenprodukte : Mikrostrukturierte Kunststoffbauteile durch Abformen eines Werkzeuges herstellen In: Der Plastverarbeiter : PV, 2010 (9), 104-106, 2010 | Bagcivan, Nazlim Bobzin, Kirsten Eilbracht, Stephan Gillner, Arnold Hartmann, Claudia Klaiber, Fritz Michaeli, Walter Scharf, Micha Christian Theiß, Sebastian |
[Journal Article] Environmentally friendly tribological systems in axial piston machines In: Tribologie und Schmierungstechnik, 57 (3), 27-31, 2010 | Murrenhoff, Hubertus Enekes, Claus Peter Gold, Peter Werner Jacobs, Georg Rombach, Volker Plogmann, Michael Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Göbbels, Nico |
[Journal Article] Influence of different pulse parameters on the deposition of Al2O3 In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 41 (8), 670-674, 2010 [DOI: 10.1002/mawe.201000653] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese |
[Journal Article] Hot Forging of C45 using PVD (Ti,Al)N/γ-Al2O3 Coated Dies In: Steel research international, 81 (7), 603-609, 2010 [DOI: 10.1002/srin.201000031] | Bobzin, Kirsten Hirt, Gerhard Springorum, F. Zitz, U. Steinhof, N. Bagcivan, Nazlim Baadjou, René Ewering, Mara Therese Immich, Philipp |
[Journal Article] Development of NiZn-Ferrite Coatings for Electromagnetic Applications In: Welding and cutting, 9 (2), 111-116, 2010 | Talaka, Tatiana Ilyuschencko, Alexander Weil, Carsten Linden, Ismo McCartney, Graham Zhang, Deen Yellup, John Y. Brühl, Markus Bobzin, Kirsten |
[Journal Article] Understanding HPPMS PVD In: Europhysics news, 41 (3), 14-15, 2010 | Theiß, Sebastian Bibinov, N. Bagcivan, Nazlim Ewering, Mara Therese Awakowicz, Peter Bobzin, Kirsten |
[Abstract, Journal Article] Time resolved optical emission spectroscopy of an HPPMS coating process In: Journal of physics / D, Applied physics, 43 (7), 8-8, 2010 [DOI: 10.1088/0022-3727/43/7/075205] | Theiß, Sebastian Bibinov, Nikita Bagcivan, Nazlim Ewering, Mara Therese Awakowicz, Peter Bobzin, Kirsten |
[Journal Article] Microstructure and complex magnetic permeability of thermally sprayed NiZn ferrite coatings for electromagnetic wave absorbers In: Surface engineering, 26 (6), 484-490, 2010 [DOI: 10.1179/026708410X12687356948634] | Brühl, Markus Zhang, Deen Talaka, Tatiana Weil, Carsten Linden, Ismo Bobzin, Kirsten Ilyuschencko, Alexander McCartney, Graham Yellup, John Y. |
[Journal Article] Crystalline γ-Alumina Deposited in an Industrial Coating Unit for Demanding Turning Operations In: Advanced engineering materials, 12 (1/2), 75-79, 2010 [DOI: 10.1002/adem.200900232] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese |
[Journal Article] Modeling of Coating Process, Phase Changes, and Damage of Plasma Sprayed Thermal Barrier Coatings on Ni-Base Superalloys In: Advanced engineering materials, 12 (3), 110-126, 2009 [DOI: 10.1002/adem.201000023] | Beck, Tilmann Bialas, Marcin Bednarz, Piotr Singheiser, Lorenz Bobzin, Kirsten Bagcivan, Nazlim Parkot, Daniel Kashko, Tatyana Petkovic, Jvica Hallstedt, Bengt Nemna, Sergey Schneider, Jochen M. |
[Journal Article] Simulation of PYSZ particle impact and solidification in atmospheric plasma spraying coating process In: Surface & coatings technology, 204 (8), 1211-1215, 2010 [DOI: 10.1016/j.surfcoat.2009.10.028] | Bobzin, Kirsten Bagcivan, Nazlim Parkot, Daniel Petkovic, Ivica |
[Journal Article] Microstructure and properties of HVOF sprayed AP40 bioactive glass-ceramic coatings In: Beijing-Gongye-Daxue-xuebao : jikan = Journal of Beijing University of Technology, 35 (3), 374-377, 2009 | Ding-Yong, He Li-Dong, Zhao |
[Abstract, Contribution to a conference proceedings, Journal Article] Modified plastic surfaces for growth of adherent cells, localized genetic modification and cell selection In: Human gene therapy, 20 (11), 1436-1436, 2009 | Meyring, Wilhelm Schoen, Oliver Zghoul, Nadia Pohl, Susanne Dohse, Antje Thomas, Michael Garritsen, Henk Woermann, Bernhard Dittmar, Kurt Lindenmaier, Werner |
[Contribution to a conference proceedings, Journal Article] Impact behavior of (Ti,Al,Si)N deposited by HPPMS In: Thin solid films, 518 (5), H2-2-7, 2009 | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Theiß, Sebastian Bolz, Stephan Frédéric |
[Journal Article] Crystalline y-Al2O3 Coating for Steel Thixoforging Tools In: Journal of nanoscience and nanotechnology, 9 (Special issue), 2009 | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Khizhnyakova, Luidmila |
[Journal Article] Challenging gold based filler metals for uses in medicine In: Materials science and technology : MST, 25 (12), 1422-1431, 2009 [DOI: 10.1179/174328407X226590] | Bobzin, Kirsten Lugscheider, Erich Ernst, F. Rösing, J. Ferrara, S. |
[Journal Article] Entwicklung von Diffusionssperrschichten für CFC-Bauteile mittels thermischer Spritztechnik In: Thermal spray bulletin, 2 (1), 34-38, 2009 | Bobzin, Kirsten Zhao, Lidong Schläfer, Thomas Warda, Thomas |
[Journal Article] Influence of the definition of the representative volume element on the effective thermoelastic properties of thermal barrier coatings with random microstructure In: Journal of thermal spray technology : JTST, 18 (5/6), 988-995, 2009 [DOI: 10.1007/s11666-009-9351-0] | Bobzin, Kirsten Bagcivan, Nazlim Parkot, Daniel Kashko, Tatyana Laschet, Gottfried Scheele, Josef |
[Journal Article] Surface-brazed wear protection systems for titanium alloys In: Welding and cutting, 8 (4), 211-213, 2009 | Bobzin, Kirsten Ernst, Felix Björn Gustav Schlegel, Arne Kopp, Nils |
[Journal Article] Skalenübergreifende Simulation teilkristalliner Thermoplaste In: Werkstoffe in der Fertigung : die Fachzeitschrift für technische Führungskräfte, 2009 (5), 33-34, 2009 | Michaeli, Walter Baranowski, Thomas Heesel, Barbara Bobzin, Kirsten Kashko, Tatyana Parkot, Daniel Bagcivan, Nazlim |
[Contribution to a conference proceedings, Journal Article] Effect of the Substrate Geometry on Plasma Synthesis of DLC Coatings In: Plasma processes and polymers, 6.2009 (6/7), 425-S428, 2009 [DOI: 10.1002/ppap.200931010] | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico Yilmaz, Koray |
[Journal Article] Effect of heat treatment on the microstructure and mechanical properties of Fe-based amorphous coatings In: Journal of alloys and compounds : JAL, 480 (2), 422-427, 2009 [DOI: 10.1016/j.jallcom.2009.02.107] | Fu, Bin-you He, Ding-yong Zhao, Lidong |
[Journal Article] Microstructure characterisation and wear properties of arc sprayed NiB containing amorphous coatings In: Surface engineering, 25 (4), 326-332, 2009 [DOI: 10.1179/026708409X364966] | Fu, Bin-you He, Ding-Yong Zhao, Lidong Li, X. Y. |
[Journal Article] Microstructure and properties of arc sprayed coatings containing Fe based amorphous phase and nanocrystallites In: Surface engineering, 25 (4), 333-337, 2009 [DOI: 10.1179/026708409X396060] | Fu, Bin-You He, Ding-Yong Zhao, Lidong Jiang, J. M. Li, X.Y. |
[Contribution to a conference proceedings, Journal Article] Arc Ion Plating Process Monitoring by Optical Emission Spectroscopy Exemplified for Chromium Containing Coatings In: Plasma processes and polymers, 6.2009 (6/7), S357-S361, 2009 [DOI: 10.1002/ppap.200930806] | Bobzin, Kirsten Bagcivan, Kirsten Immich, Philipp Theiß, Sebastian |
[Journal Article] Investigation of Properties and Wear Behavior of HVOF Sprayed TiC-Strengthened Fe Coatings In: Journal of thermal spray technology : JTST, 18 (4), 672-677, 2009 [DOI: 10.1007/s11666-009-9384-4] | Bobzin, Kirsten Schläfer, Thomas Richardt, Katharina Rebecca Maria Warda, Thomas Reisel, Guido |
[Journal Article] Modeling and Simulation of Microstructure Formation for Porosity Prediction in Thermal Barrier Coatings Under Air Plasma Spraying Condition In: Journal of thermal spray technology : JTST, 18 (5), 975-980, 2009 [DOI: 10.1007/s11666-009-9340-3] | Bobzin, Kirsten Bagcivan, Nazlim Parkot, Daniel Schäfer, Marcel Pascal Petkovic, Ivica |
[Contribution to a conference proceedings, Journal Article] Lubricated PVD CrAlN and WC/C coatings for automotive applications In: Surface & coatings technology, 204 (6/7), 1097-1101, 2009 [DOI: 10.1016/j.surfcoat.2009.07.045] | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico Yilmaz, Koray Höhn, Bernd-Robert Michaelis, Klaus Hochmann, Michael |
[Journal Article] Development of NiZn-ferrite coatings for electromagnetic applications In: Thermal spray bulletin, 2 (2), 126-132, 2009 | Talaka, Tatiana Ilyuschencko, Alexander Weil, Carsten Linden, Ismo McCartney, Graham Zhang, Deen Yellup, John Y. Brühl, Markus Bobzin, Kirsten |
[Journal Article] Detektion von Verunreinigungen beim bleifreien Wellen- und Selektivlöten und deren Auswirkungen auf die Lötstelle In: Schweissen und Schneiden, 61 (7), 358-368, 2009 | Bach, Friedrich-Wilhelm Möhwald, Kai Schaup, Jörg Holländer, Ulrich Herzog, Thomas Wohlrabe, Heinz Wielage, Bernhard Lampke, Thomas Weber-Nester, Daisy Bobzin, Kirsten |
[Journal Article] PVD Beschichtung von Polyetheretherketon (PEEK) zur Verschleiß- und Reibungsminimierung im Kontakt Käfig-Führungsbord eines Spindellagers In: Tribologie und Schmierungstechnik, 56, 11-15, 2009 | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico |
[Contribution to a conference proceedings, Journal Article] Properties of (Ti,Al,Si)N coatings for high demanding metal cutting applications deposited by HPPMS in an industrial coating unit In: Plasma processes and polymers, 6.2009 (6/7), S124-128, 2009 [DOI: 10.1002/ppap.200930408] | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Bolz, Stephan Frédéric Fuß, Hans-Gerd Cremer, Rainer |
[Journal Article] Preparation of barium hexaferrite coatings using atmospheric plasma spraying In: Journal of the European Ceramic Society, 29 (11), 2333-2341, 2009 [DOI: 10.1016/j.jeurceramsoc.2009.01.028] | Lisjak, Darja Bobzin, Kirsten Richardt, Katharina Rebecca Maria Bégard, Marion Bolelli, Giovanni Lusvarghi, Luca Hujanen, Arto Lintunen, Pertti Pasquale, Massimo Olivetti, Elena Drofenik, Miha Schläfer, Thomas |
[Journal Article] Wiederaufarbeitung von Motorzylinderbohrungen durch Spritzreparatur unter Anwendung des PTWA-Verfahrens (Plasma Transferred Wire Arc) In: Thermal spray bulletin, 2 (1), 26-31, 2009 | Bobzin, Kirsten Schläfer, Thomas Beardsley, Brad Gerke, Dan Sharp, Bob Blume, Fritz Silk, Mark Schramm, Leander Schwenk, Alexander Lindon, Spencer |
[Journal Article] Entwicklung von eisenbasierten Spritzzusatzwerkstoffen und deren Verarbeitung durch Lichtbogenspritzen In: Thermal spray bulletin, 2 (1), 58-63, 2009 | Bobzin, Kirsten Zhao, Lidong Schläfer, Thomas Kutschmann, Pia |
[Journal Article] Eigenschaftsoptimierung eines niedriglegierten Stahls mittels PVD- (Physical Vapour Deposition) Technologie In: Jahrbuch Oberflächentechnik, 65, 103-108, 2009 | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico Weiß, Raphael |
[Journal Article] Investigations on nanolaminated TiZrN/CrN as a tribological PVD hard coating for incremental sheet forming tools In: Advanced engineering materials, 11 (8), 674-679, 2009 [DOI: 10.1002/adem.200900088] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Warnke, Carsten |
[Journal Article] Thermal investigation of Al2O3 thin films for application in cutting operations In: Advanced engineering materials, 11 (7), 590-594, 2009 [DOI: 10.1002/adem.200800421] | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Ewering, Mara Therese |
[Contribution to a conference proceedings, Journal Article] High power pulsed magnetron sputtering: fundamentals and applications In: Journal of alloys and compounds : JAL, 483.2009 (1/2), 530-534, 2009 [DOI: 10.1016/j.jallcom.2008.08.104] | Alami, Jones Bolz, Stephan Frédéric Sarakinos, Kostas |
[Journal Article] Thermal spraying of Co,Ti-substituted Ba-hexaferrite coatings for electromagnetic wave absorption applications In: Surface & coatings technology, 203 (20/21), 3312-3319, 2009 [DOI: 10.1016/j.surfcoat.2009.04.007] | Bégard, Marion Bobzin, Kirsten Bolelli, Giovanni Hujanen, Arto Lintunen, Pertti Lisjak, Darja Gyergyek, Sašo Lusvarghi, Luca Pasquale, Massimo Richardt, Katharina Rebecca Maria Schläfer, Thomas Varis, Tommi |
[Journal Article] Hybridprozessentwicklung zur Plasmasynthese temperaturbeständiger Kohlenstoffschichten In: WING, 2009, 2009 | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Yilmaz, Koray |
[Journal Article] Advancement of a nanolaminated TiHfN/CrN PVD tool coating by a nano-structured CrN top layer in interaction with a biodegradable lubricant for green metal forming In: Surface & coatings technology, 203 (20/21), 3184-3188, 2009 [DOI: 10.1016/j.surfcoat.2009.03.053] | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Warnke, Carsten Klocke, Fritz Zeppenfeld, Christoph Mattfeld, Patrick |
[Journal Article] Advantages of nanocomposite coatings deposited by high power pulse magnetron sputtering technology In: Journal of materials processing technology, 209 (1), 165-170, 2009 [DOI: 10.1016/j.jmatprotec.2008.01.035] | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Bolz, Stephan Frédéric Alami, Jones Cremer, Rainer |
[Journal Article] Development of a new wear resistant coating by arc spraying of a steel-based cored wire In: Frontiers of mechanical engineering in China, 4 (1), 7-10, 2008 [DOI: 10.1007/s11465-009-0012-2] | Zhao, Lidong Binyou Fu Dingyong He Kutschmann, Pia |
[Journal Article] Untersuchung zum flussmittelfreien Löten einer AlMg3-Legierung mit Hilfe der Kaltgasbelotung In: Thermal spray bulletin, 1 (1), 50-54, 2008 | Bobzin, Kirsten Lugscheider, Erich Ernst, Felix Björn Gustav Richardt, Katharina Rebecca Maria Zhao, Lidong |
[Journal Article] Neue HPPMS-Technologie - Zerspanwerkzeuge hochpulsig beschichten In: Journal für Oberflächentechnik : JOT, 48 (1), 34-35, 2008 | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Bolz, Stephan Frédéric |
[Journal Article] HyDraNo In: WING : das Jahrbuch, 2007, 2008 | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico |
[Journal Article] NaCoLab In: WING : das Jahrbuch, 2007, 2008 | Bobzin, Kirsten Ernst, Felix Björn Gustav Schläfer, Thomas Richardt, Katharina Rebecca Maria |
[Journal Article] Hybridprozessentwicklung zur Plasmasynthese temperaturbeständiger Kohlenstoffschichten In: WING, 2008, 2008 | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Yilmaz, Koray |
[Journal Article] PVD - Eine Erfolgsgeschichte mit Zukunft In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 39 (1), 5-12, 2008 [DOI: 10.1002/mawe.200700252] | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Pinero, Carmen Göbbels, Nico Krämer, Anika |
[Journal Article] Zukunftsweisende Werkstoffkombinationen und Beschichtung beliebiger Konturen möglich In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 100 (1), 192-193, 2008 | Bobzin, Kirsten |
[Journal Article] Thermisch gespritzte titankarbidverstärkte Eisenbasisschichten als Alternative zu konventionellen karbidischen Werkstoffen In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 39 (1), 13-17, 2008 [DOI: 10.1002/mawe.200700235] | Bobzin, Kirsten Ernst, Felix Björn Gustav Richardt, Katharina Rebecca Maria Warda, Thomas Reisel, Guido |
[Journal Article] A look at the development of magnesium-based filler metals In: Welding journal, 87 (3), 38-40, 2008 | Bobzin, Kirsten Lugscheider, Erich Ernst, Felix Björn Gustav Schlegel, Arne Rösing, Jürgen Jäger, Doris |
[Journal Article] Developing PVD zirconium-oxide coatings for use of thixoforming of steel In: International journal of microstructure and materials properties : IJMMP, 3 (2/3), 267-270, 2008 [DOI: 10.1504/IJMMP.2008.018733] | Bobzin, Kirsten Lugscheider, Erich Maes, Michael Immich, Philipp |
[Journal Article] Mikrostruktur und Eigenschaften lichtbogengespritzter Schichten auf Eisenbasis In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 39 (12), 867-870, 2008 [DOI: 10.1002/mawe.200800393] | Bobzin, Kirsten Schläfer, Thomas Richardt, Katharina Rebecca Maria Zhao, Lidong Kutschmann, Pia |
[Journal Article] Coating bores of light metal engine blocks with a nanocomposite material using the plasma transferred wire arc thermal spray process In: Journal of thermal spray technology : JTST, 17 (3), 344-351, 2008 [DOI: 10.1007/s11666-008-9188-y] | Bobzin, Kirsten Ernst, Felix Björn Gustav Zwick, Jochen Bernt Schläfer, Thomas Cook, David Nassenstein, Klaus Schwenk, Alexander Schreiber, Frank Wenz, Thomas Flores, Gerhard Hahn, Mareike |
[Contribution to a conference proceedings, Journal Article] Solders development and application process for a micro chip-camera In: Microsystem technologies, 14.2008 (12), 1887-1894, 2008 [DOI: 10.1007/s00542-008-0613-4] | Bobzin, Kirsten Lugscheider, Erich Ernst, Felix Björn Gustav Nickel, Reimo Bagcivan, Nazlim Parkot, Daniel Schlegel, Arne Ferrara, Stefania Kashko, Tatyana Leick, Noémi |
[Journal Article] Untersuchung des Benetzungsverhaltens von Schmierstoffen auf PVD-beschichteten Oberflächen und dessen Einfluss auf tribologische Eigenschaften In: Tribologie und Schmierungstechnik, 55 (1), 5-9, 2008 | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Yilmaz, Koray |
[Journal Article] Untersuchung des Einflusses unterschiedlicher Karbidbildner auf das tribologische Verhalten mittels reaktivem Magnetron-Sputter-Ion-Plating MSIP abgeschiedener Nanocomposite nc-MeC/a-C:H Beschichtungen In: Tribologie und Schmierungstechnik, 55 (2), 5-10, 2008 | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Göbbels, Nico |
[Journal Article] Anwendungen von Modellierung und Simulation zur Vorhersage der Spritzpartikel-Morphologie unter APS-Prozessbedingungen In: Thermal spray bulletin, 1 (2), 114-118, 2008 | Bobzin, Kirsten Bagcivan, Nazlim Parkot, Daniel Petkovic, Ivica |
[Contribution to a conference proceedings, Journal Article] Thermal spraying of cylinder bores with the plasma transferred wire arc process In: Surface & coatings technology, 202 (18), 4438-4443, 2008 [DOI: 10.1016/j.surfcoat.2008.04.023] | Bobzin, Kirsten Ernst, Felix Björn Gustav Richardt, Katharina Rebecca Maria Schläfer, Thomas Verpoort, Clemens Flores, Gerhard |
[Journal Article] Qualitätssicherung durch On-Line Prozessdiagnostik In: Schweissen und Schneiden, 60 (2), 84-87, 2008 | Bobzin, Kirsten Ernst, Felix Björn Gustav Zwick, Jochen Bernt Richardt, Katharina Rebecca Maria Landes, Klaus Zierhut, Jochen |
[Journal Article] Vorteile superharter Nanocomposite Beschichtungen für Zerspanwerkzeuge, abgeschieden mittels High Power Pulse Magnetron Sputtering In: Jahrbuch Oberflächentechnik, 64, 81-88, 2008 | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Bolz, Stephan Frédéric |
[Journal Article] Hydrano - Leistungssteigerung hydraulischer Verdrängereinheiten durch Nanocomposites In: WING, 2008, 2008 | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico |
[Journal Article] Flux-free brazing of Mg-containing aluminium alloys by means of cold spraying In: Frontiers of mechanical engineering in China, 3 (4), 355-359, 2008 [DOI: 10.1007/s11465-008-0055-9] | Bobzin, Kirsten Zhao, Lidong Ernst, Felix Björn Gustav Richardt, Katharina Rebecca Maria |
[Journal Article] Die Oberfläche macht den Unterschied : der systemische Lösungsansatz in der industriellen Plasma-Oberflächentechnik In: Intelligenter produzieren, 2008 (4), 10-12, 2008 | Bobzin, Kirsten Bagcivan, Nazlim |
[Journal Article] Development of oxide dispersion strengthened MCrAlY coatings In: Journal of thermal spray technology : JTST, 17 (5/6), 853-857, 2008 [DOI: 10.1007/s11666-008-9244-7] | Bobzin, Kirsten Schläfer, Thomas Richardt, Katharina Rebecca Maria Brühl, Markus |
[Journal Article] Verschleißschutz durch thermisches Spritzen : Stand und Perspektiven In: Stahl, 2008 (3), 28-30, 2008 | Bobzin, Kirsten Schläfer, Thomas Richardt, Katharina Rebecca Maria Kutschmann, Pia |
[Journal Article] Tailor-made coatings for turbine applications using the Triplex Pro 200 In: Journal of thermal spray technology : JTST, 17 (5/6), 612-616, 2008 [DOI: 10.1007/s11666-008-9236-7] | Richardt, Katharina Rebecca Maria Bobzin, Kirsten Sporer, Dieter Schläfer, Thomas Fiala, Petr |
[Contribution to a conference proceedings, Journal Article] Mechanical properties and oxidation behaviour of (Al,Cr)N and (Al,Cr,Si)N coatings for cutting tools deposited by HPPMS In: Thin solid films, 517 (3), 1251-1256, 2008 [DOI: 10.1016/j.tsf.2008.06.050] | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Bolz, Stephan Frédéric Cremer, Rainer Leyendecker, Thorsten |
[Journal Article] An extremely successful ITSC 2008 In: Thermal spray bulletin, 1 (2), 90-92, 2008 | Bobzin, Kirsten Schläfer, Thomas Richardt, Katharina Rebecca Maria Brühl, Markus |
[Journal Article] Titankarbidverstärkte Eisenbasiswerkstoffe : eine kostengünstige Lösung für Verschleißschutzanwendungen In: Thermal spray bulletin, 1 (2), 120-126, 2008 | Bobzin, Kirsten Schläfer, Thomas Richardt, Katharina Rebecca Maria Warda, Thomas Reisel, Guido |
[Contribution to a book, Contribution to a conference proceedings, Journal Article] Deposition of oxides as tool protection for large thixoforming dies by using the pulsed MSIP-PVD process In: Diffusion and defect data - solid state data : Pt. B. Solid state phenomena, 141/143, 249-254, 2008 [DOI: 10.4028/3-908451-59-0.249] | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp |
[Journal Article] Der Exzellenzcluster Integrative Produktionstechnik für Hochlohnländer der RWTH Aachen University : Herstellung hybrider Metall-Kunststoffbauteile durch moderne Fügeverfahren In: Joining plastics = Fügen von Kunststoffen, 2 (3), 210-216, 2008 | Bobzin, Kirsten Theiß, Sebastian Poprawe, Reinhart Rösner, Andreas Haberstroh, Edmund Flock, Dustin Reisgen, Uwe Wagner, Nikolaus |
[Journal Article] Thermisches Spritzen : Potentiale, Entwicklungen, Märkte In: Thermal spray bulletin, 1 (1), 30-36, 2008 | Wielage, Bernhard Rupprecht, Christian Brühl, Markus Richardt, Katharina Rebecca Maria Ernst, Felix Björn Gustav Bobzin, Kirsten |
[Journal Article] Auftraggelötete Verschleißschutzsysteme für Titanlegierungen In: Schweissen und Schneiden, 60 (10), 566-570, 2008 | Kopp, Nils Schlegel, Arne Ernst, Felix Björn Gustav Bobzin, Kirsten |
[Journal Article] Microstructure based model for permeability predictions of open-cell metallic foams via homogenization In: Materials science & engineering / A, Structural materials: properties, microstructure and processing, 472 (1/2), 214-226, 2008 [DOI: 10.1016/j.msea.2007.03.046] | Laschet, Gottfried Kashko, Tatyana Angel, Stefanie Scheele, Josef Nickel, Reimo Bobzin, Kirsten Bleck, Wolfgang |
[Contribution to a conference proceedings, Journal Article] High-temperature brazing for reliable tungsten-CFC joints In: Physica scripta, T128, 175-181, 2007 [DOI: 10.1088/0031-8949/2007/T128/034] | Koppitz, Th. Pintsuk, G. Reisgen, Uwe Remmel, Josef Hirai, T. Sievering, R. Rojas Yoris, Yelena Casalegno, V. |
[Journal Article] Hydroxylapatite coatings by microplasma spraying In: Wuji-cailiao-xuebao : jikan = Journal of inorganic materials, 22 (4), 754-758, 2007 [DOI: 10.3724/SP.J.1077.2007.00754] | He, Ding-Yong Sun, Xu-Feng Zhao, Lidong |
[Contribution to a conference proceedings, Journal Article] Wear behavior of Cr1-xAlxNPVD-coatings in dry running conditions In: Wear, 263 (7/12), 1274-1280, 2007 [DOI: 10.1016/j.wear.2007.01.118] | Bobzin, Kirsten Lugscheider, Erich Nickel, R. Bagcivan, Nazlim Krämer, A. |
[Journal Article] Microstructure dependency of the material properties: Simulation approaches and calculation methods for non-homogeneous materials In: Steel research international, 78 (10/11), 804-811, 2007 | Bobzin, Kirsten Nickel, Reimo Parkot, Daniel Kashko, Tatyana |
[Journal Article] C-Schichten In: WING, 2006, 2007 | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico Yilmaz, Koray |
[Journal Article] Beschichtungsanlage für neue Werkstoffkombinationen : IOT mit Beschichtungsanlage der neuesten Generation In: Werkstoffe in der Fertigung : die Fachzeitschrift für technische Führungskräfte, 2007 (6), 2007 | Bobzin, Kirsten |
[Journal Article] Beschichtungsanlage für neue Werkstoffkombinationen : IOT mit Beschichtungsanlage der neuesten Generation In: Aluminium : international journal for industry, research and application, 83, 81-81, 2007 | Bobzin, Kirsten |
[Journal Article] Fügen mittels Kaltgasspritzen In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 98 (11), 2804-2805, 2007 | Bobzin, Kirsten |
[Journal Article] Beschichtungsanlage für neue Werkstoffkombinationen : IOT mit Beschichtungsanlage der neuesten Generation In: Journal für Oberflächentechnik : JOT, 6 (12), 2007 | Bobzin, Kirsten |
[Journal Article] Entwicklung und Charakterisierung einer Nanocomposite nc-ZrC/a-C:H Beschichtung für den Einsatz in hydraulischen Verdrängereinheiten In: Tribologie und Schmierungstechnik, 54 (4), 5-11, 2007 | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Göbbels, Nico |
[Journal Article] Verschleißschutz für Titanbauteile In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 38 (2), 160-163, 2007 [DOI: 10.1002/mawe.200600106] | Bobzin, Kirsten Ernst, Felix Björn Gustav Rösing, Jürgen Rojas Yoris, Yelena |
[Journal Article] Hochtemperaturlöten als Reparaturverfahren zur Erweiterung der Lebensdauer einkristalliner Turbinenkomponenten In: Schweissen und Schneiden, 59 (5), 249-252, 2007 | Bobzin, Kirsten Ernst, Felix Björn Gustav Rösing, Jürgen Schlegel, Arne Rojas Yoris, Yelena |
[Journal Article] Auftraglöten zum Verschleißschutz von Titanwerkstoffen In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 38 (7), 533-537, 2007 [DOI: 10.1002/mawe.200700164] | Bobzin, Kirsten Ernst, F. Rösing, J. Rojas, Y. |
[Journal Article] Kaltgasspritzen von Al-basierten Lotwerkstoffen zum Löten von Aluminium und Aluminiumlegierungen In: Info-Service / Fachgesellschaft Löten, 16, 16-18, 2007 | Bobzin, Kirsten Zhao, Lidong Kutschmann, Pia |
[Journal Article] Investigation of particle flattening behaviour and bonding mechanisms of APS sprayed coatings on magnesium alloys In: Surface & coatings technology, 201 (14), 6290-6296, 2007 [DOI: 10.1016/j.surfcoat.2006.11.034] | Bobzin, Kirsten Lugscheider, Erich Zwick, Jochen Bernt Zhao, Lidong Parco, Maria |
[Journal Article] Ökonomische und umweltverträgliche Umformtechnologien durch hochspezialisierte, funktionelle PVD-Werkzeugbeschichtungen In: Jahrbuch Oberflächentechnik, 63, 64-70, 2007 | Bobzin, Kirsten Nickel, Reimo Immich, Philipp Pinero, Carmen Warnke, Carsten |
[Journal Article] PVD-Coatings in injection molding machines for processing optical polymers In: Plasma processes and polymers, 4 (Suppl. 1), S144-S149, 2007 [DOI: 10.1002/ppap.200730507] | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Manz, Florian |
[Journal Article] Determination of multi parametical transversely isotropic coating properties based on simulation of nanoindentation In: International journal of surface science and engineering, 1 (2/3), 293-307, 2007 [DOI: 10.1504/IJSURFSE.2007.015030] | Bobzin, Kirsten Nickel, Reimo Parkot, Daniel Hurevich, Vitalii Göbbels, Nico |
[Contribution to a book, Contribution to a conference proceedings, Journal Article] Application of thermal barrier coatings on open porous metallics foams In: Plasma processes and polymers, 4.2007 (Suppl.1), S547-S550, 2007 [DOI: 10.1002/ppap.200731403] | Bobzin, Kirsten Lugscheider, Erich Nickel, Reimo Bagcivan, Nazlim |
[Contribution to a book, Contribution to a conference proceedings, Journal Article] Pulsed nanocomposite TiAlN coatings on complex shaped tools for high performance cutting operations In: Plasma processes and polymers, 4.2007 (Suppl.1), S673-S676, 2007 [DOI: 10.1002/ppap.200731703] | Bobzin, Kirsten Lugscheider, Erich Nickel, Reimo Immich, Philipp Bolz, Stephan Frédéric Klocke, Fritz |
[Journal Article] Analyse von Partikeleigenschaften beim Thermischen Spritzen von Mikropulvern In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 38 (2), 149-154, 2007 [DOI: 10.1002/mawe.200600109] | Bobzin, Kirsten Lugscheider, Erich Ernst, Felix Björn Gustav Zwick, Jochen Bernt Matthäus, Götz |
[Journal Article] Modeling and simulation in the production process control and material property calculation of complex structured EB-PVD TBCs In: Computational materials science, 39 (3), 600-610, 2007 [DOI: 10.1016/j.commatsci.2006.08.011] | Bobzin, Kirsten Lugscheider, Erich Nickel, Reimo |
[Journal Article] Beschichtung von Zylinderlaufflächen moderner PKW-Motoren mit niedriglegierten Stählen und einem nanokristallinen Kompositwerkstoff In: Tribologie und Schmierungstechnik, 54 (2), 11-16, 2007 | Bobzin, Kirsten Lugscheider, Erich Ernst, Felix Björn Gustav Zwick, Jochen Bernt Schläfer, Thomas |
[Journal Article] Study on cold spraying of Al-based brazing alloys In: Journal of thermal spray technology : JTST, 13 (2), 29-36, 2007 | Zhao, Lidong Zwick, Jochen Bernt Ernst, Felix Björn Gustav Bobzin, Kirsten Lugscheider, Erich |
[Journal Article] Numerical studies of the application of shock tube technology for cold gas dynamic spray process In: Journal of thermal spray technology : JTST, 16 (5/6), 729-735, 2007 [DOI: 10.1007/s11666-007-9123-7] | Nickel, Reimo Bobzin, Kirsten Lugscheider, Erich Parkot, Daniel Varava, Waldemar Olivier, Herbert Luo, Xisheng |
[Journal Article] Open porous metallic foams with thermal barrier coating and cooling hole array for high temperature turbine applications In: High temperature material processes, 11 (3), 321-343, 2007 [DOI: 10.1615/HighTempMatProc.v11.i3.20] | Angel, Stefanie Ratte, Evelin Bleck, Wolfgang Bobzin, Kirsten Lugscheider, Erich Nickel, R. Richardt, Katharina Rebecca Maria Bagcivan, Nazlim Walther, K. Kreutz, E. W. Kelbassa, Ingomar Poprawe, Reinhart |
[Journal Article] PVD-Beschichtungen für trockenlaufende Hybridwälzlager In: Vakuum in Forschung und Praxis : VIP, 19 (2), 6-12, 2007 [DOI: 10.1002/vipr.200700313] | Gold, Peter Werner Loos, Jörg Plogmann, Michael Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Krämer, Anika |
[Contribution to a conference proceedings, Journal Article] Grain size evaluation of pulsed TiAlN nanocomposite coatings for cutting tools In: Thin Solid Films, 515 (3), 3681-3684, 2006 [DOI: 10.1016/j.tsf.2006.11.002] | Bobzin, Kirsten Lugscheider, E. Maes, M. Immich, P. Bolz, S. (Corresponding author) |
[Journal Article] Wirtschaftliche Kaltmassivumformung - Neue Werkzeugbeschichtungen machen Verzicht auf Bonderbehandlung möglich In: Industrie-Anzeiger, 34/35, 43-43, 2006 | Bobzin, Kirsten Klocke, Fritz Zeppenfeld, Christoph Maßmann, Thomas Christoph Maes, Michael Pinero, Carmen Raedt, Hans-Willi |
[Journal Article] Investigation of HVOF spraying on magnesium alloys In: Surface and coatings technology, 201 (6), 3269-3274, 2006 [DOI: 10.1016/j.surfcoat.2006.06.047] | Parco, Maria (Corresponding author) Zhao, Lidong Zwick, Jochen Bernt Bobzin, Kirsten Lugscheider, Erich |
[Journal Article] Improvement of thermally sprayed abradable coating by microstructure control In: Surface & coatings technology, 201 (6), 2303-2312, 2006 [DOI: 10.1016/j.surfcoat.2006.03.047] | Faraoun, H. I. Grosdidier, T. Seichepine, J.-L. Goran, D. Aourag, H. Coddet, C. Zwick, Jochen Bernt Hopkins, Noel |
[Journal Article] Alternative methods for determination of composition and porosity in abradable materials In: Materials characterization, 57 (1), 17-29, 2006 [DOI: 10.1016/j.matchar.2005.12.004] | Matejicek, Jiri Kolman, Blahoslav Dubsky, Jiri Neufuss, Karel Hopkins, Noel Zwick, Jochen Bernt |
[Contribution to a conference proceedings, Journal Article] Modelling route for abradable coatings In: Surface & coatings technology, 200 (22/23), 6578-6582, 2006 [DOI: 10.1016/j.surfcoat.2005.11.105] | Faraoun, H. I. Seichepine, J. L. Coddet, C. Aourag, H. Zwick, Jochen Bernt Hopkins, Noel Sporer, Dieter Hertter, M. |
[Journal Article] High kinetic process developments in thermal spray technology In: Journal of thermal spray technology : JTST, 15 (2), 155-156, 2006 [DOI: 10.1361/105996306X108246] | Lugscheider, Erich |
[Contribution to a book, Journal Article] Thermal spraying developments In: Advanced engineering materials, 8 (7), 595-596, 2006 | Berndt, C. Bobzin, Kirsten Coddet, C. Fauchais, P. Lugscheider, Erich Möhwald, K. Singheiser, L. Vardelle, A. |
[Journal Article] C-Schichten In: WING : das Jahrbuch ; Projekte, Events und Ergebnisse / Projektträger Jülich, Forschungszentrum Jülich GmbH, 2006 | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Yilmaz, Koray |
[Journal Article] HyDraNo - Leistungsteigerung in hydraulischen Verdrängereinheiten durch Nanocomposites In: WING : das Jahrbuch, 2006, 97-97, 2006 | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Göbbels, Nico |
[Journal Article] NaCoLab : Nanokristalline Composit-Beschichtungen für Zylinderlaufbahnen mit nanostrukturierter Oberfläche und Verschleißvorhersage für hochbelastete Benzin- und Dieselmotoren In: WING : das Jahrbuch, 2006, 29-29, 2006 | Bobzin, Kirsten Ernst, Felix Björn Gustav Zwick, Jochen Bernt Schläfer, Thomas |
[Journal Article] Qualitätssicherung durch online Prozessdiagnostik In: Metalloberfläche : mo, 60 (11), 44-48, 2006 | Bobzin, Kirsten Ernst, Felix Björn Gustav Richardt, Katharina Rebecca Maria Zwick, Jochen Bernt Landes, Klaus Forster, G. Zierhut, Jochen |
[Journal Article] Aufwendige Vorbehandlung erübrigt sich : Werkzeugbeschichtungen: Kaltmassivumformen wird Effizienter In: Industrie-Anzeiger, 128 (35), 43-43, 2006 | Klocke, Fritz Zeppenfeld, Christoph Maßmann, Thomas Christoph Bobzin, Kirsten Maes, Michael Pinero, Carmen Raedt, Hans-Willi Filgertshofer, Robert |
[Journal Article] Werkzeugbeschichtung: Verlagerung bringt Vorteile In: Werkzeug & Formenbau, 16 (4), 27-27, 2006 | Klocke, Fritz Zeppenfeld, Christoph Maßmann, Thomas Christoph Bobzin, Kirsten Maes, Michael Pinero, Carman Raedt, Hans-Willi Filgertshofer, Robert |
[Journal Article] Umwelt schonende und wirtschaftliche Kaltmassivumformung In: Der Schnitt- & Stanzwerkzeugbau, 10 (4), 59-60, 2006 | Bobzin, Kirsten Maes, Michael Pinero, Carmen Klocke, Fritz Zeppenfeld, Christoph Maßmann, Thomas Christoph Raedt, Hans-Willi Filgertshofer, Robert |
[Journal Article] Statt der Teile die Werkzeuge beschichten : Kaltmassivumformung: Auf Bondern gänzlich verzichten In: Produktion : Technik und Wirtschaft für die deutsche Industrie, 45 (18), 10-10, 2006 | Klocke, Fritz Zeppenfeld, Christoph Maßmann, Thomas Christoph Bobzin, Kirsten Maes, Michael Pinero, Carmen Raedt, Hans-Willi Filgertshofer, Robert |
[Journal Article] Umwelt schonende und wirtschaftliche Kaltmassivumformung In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 97 (6), 1526-1527, 2006 | Bobzin, Kirsten Maes, Michael Pinero, Carmen Klocke, Fritz Zeppenfeld, Christoph Maßmann, Thomas Christoph Raedt, Hans-Willi Filgertshofer, Robert |
[Contribution to a conference proceedings, Journal Article] The Influence of Substrate Preparation on the PVD Coating Graded Zirconium Carbide (ZrCg) and Chromium Aluminium Nitride (CrAlN) In: Thin solid films, 2006, 2006 | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico Manz, Florian |
[Abstract, Contribution to a conference proceedings, Journal Article] Deposition of HA coatings by microplasma spraying In: Das Dental-Labor, 7 (1), 126-126, 2006 [DOI: 10.1515/BIOMAT.2006.7.1.7] | Bobzin, Kirsten Zwick, Jochen Bernt Zhao, Lidong |
[Journal Article] Umweltverträgliche Kaltmassivumformung - PVD-Beschichtung statt bondern In: Journal für Oberflächentechnik : JOT, 2006 (1), 30-31, 2006 | Bobzin, Kirsten Lugscheider, Erich Nickel, Reimo Immich, Philipp Pinero, Carmen Warnke, Carsten Klocke, F. Maßmann, Th. Liauw, M. Eichholz, S. Raedt, H.-W. Filgertshofer, R. |
[Journal Article] Investigation on the Thermal Behavior of Graded and Multilayered Lanthanum Zirconate as EB-PVD Thermal Barrier Coating In: Journal of vacuum science & technology / A, Vacuum, surfaces, & films, 24 (4), 2006 | Bobzin, Kirsten Lugscheider, Erich Bagcivan, Nazlim |
[Journal Article, News] Funktionelle Oberflächenbeschichtungen durch Plasmaspritzen In: PlasmaNews, 2006 (1), 2006 | Bobzin, Kirsten Lugscheider, Erich Zwick, Jochen Bernt |
[Journal Article] Eigenspannungsreduzierende Maßnahmen für flächige Lötverbindungen in der Mikrosytemtechnik In: Schweissen und Schneiden, 58 (5), 238-246, 2006 | Bach, Friedrich-Wilhelm Holländer, Ulrich Bobzin, Kirsten Varava, Waldemar Möhwald, Kai Roxlau, Christian Nickel, Reimo |
[Journal Article] Völlig abgelöst - PVD-Schichtsystem verhindert anhaftende Schmelze an Spritzgiessmaschinen In: Der Plastverarbeiter : PV, 57 (8), 42-42, 2006 | Bobzin, Kirsten Bagcivan, Nazlim Manz, Florian |
[Journal Article] PVD-Beschichtungen auf Plastifizierschnecken In: Kunststoffe / [Deutsche Ausgabe], 96 (8), 66-68, 2006 | Michaeli, Walter Bobzin, Kirsten Heßner, Sebastian Neuß, Andreas Manz, Florian |
[Journal Article] CrAlN-PVD-Niedertemperaturbeschichtung zum Verschleißschutz von Bauteilen In: Tribologie und Schmierungstechnik, 53 (1), 2889-2898, 2006 | Bobzin, Kirsten Lugscheider, Erich Maes, Michael |
[Journal Article] Einsatz von PVD/CVD-Schichten bei Wälzlagern In: Jahrbuch Oberflächentechnik, 62, 106-124, 2006 | Bobzin, Kirsten Maes, Michael |
[Journal Article] Production and characterization of NiAl-Ta-Cr intermetallic coatings sprayed by high velocity oxy-fuel In: Xiyou-jinshu-cailiao-yu-gongcheng = Rare metal materials and engineering, 35 (6), 974-977, 2006 | Zhao, Lidong He, Dingyong Bobzin, Kirsten Lugscheider, Erich |
[Contribution to a book, Contribution to a conference proceedings, Journal Article] Application of multiscale modeling in the coating formation simulation of APS PYSZ TBCs In: Journal of thermal spray technology : JTST, 15 (4), 537-544, 2006 [DOI: 10.1361/105996306X147063] | Lugscheider, Erich Bobzin, Kirsten Nickel, Reimo |
[Journal Article] Study on the influence of plasma spray processes and spray parameters on the structure and crystallinity of hydroxylapatite coatings In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 37 (6), 516-520, 2006 [DOI: 10.1002/mawe.200600029] | Zhao, Lidong Bobzin, Kirsten Ernst, Felix Björn Gustav Zwick, Jochen Bernt Lugscheider, Erich |
[Journal Article] (Cr1-x,Alx)N ein Review über ein vielseitig einsetzbares Schichtsystem In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 37 (10), 833-841, 2006 [DOI: 10.1002/mawe.200600048] | Bobzin, Kirsten Lugscheider, Erich Nickel, R. Immich, Philipp |
[Journal Article] Thermal cycling behavior of yttria stabilized zirconia and lanthanum zirconate, as graded and bilayer EB-PVD thermal barrier coatings In: High temperature material processes, 10 (1), 103-115, 2006 [DOI: 10.1615/HighTempMatProc.v10.i1.80] | Bobzin, Kirsten Lugscheider, Erich Bagcivan, Nazlim |
[Contribution to a book, Contribution to a conference proceedings, Journal Article] Alumina PVD tool coatings for the use in semi solid metal forming of steel In: Diffusion and defect data - solid state data : Pt. B. Solid state phenomena, 116/117, 704-707, 2006 [DOI: 10.4028/www.scientific.net/SSP.116-117.704] | Bobzin, Kirsten Lugscheider, Erich Maes, Michael Immich, Philipp |
[Journal Article] Microstructure and properties of atmospheric plasma sprayed AP40 bioactive glass-ceramic coatings In: Wuji-cailiao-xuebao : jikan = Journal of inorganic materials, 21 (3), 759-763, 2006 [DOI: 10.3724/SP.J.1077.2006.00759] | He, Ding-Yong Zhao, Lidong Bobzin, Kirsten Lugscheider, Erich |
[Journal Article] New soldering processes and solder systems for hybrid microsystems : developments and applications In: Microsystem technologies, 12 (7), 620-625, 2006 [DOI: 10.1007/s00542-006-0079-1] | Bobzin, Kirsten Lugscheider, Erich Zhuang, H. Ernst, Felix Björn Gustav Bagcivan, Nazlim Maes, Michael Rösing, J. Ferrara, Stefania Erdle, Anja Krämer, A. |
[Journal Article] Atmospheric plasma spraying of thermal barrier coating material ZrO2-7%/Y2O3 using on-line particle monitoring In: Advanced engineering materials, 8 (4), 268-270, 2006 [DOI: 10.1002/adem.200500272] | Zhao, Lidong Bobzin, Kirsten Ernst, Felix Björn Gustav Lugscheider, Erich |
[Journal Article] Feasibility study of brazing aluminium alloys through pre-deposition of a braze alloy by cold spray process In: Advanced engineering materials, 8 (8), 751-753, 2006 [DOI: 10.1002/adem.200600001] | Zhao, Lidong Bobzin, Kirsten Ernst, Felix Björn Gustav Zwick, Jochen Bernt Rösing, Jürgen Lugscheider, Erich |
[Contribution to a book, Journal Article] Assessment of the microplasma spraying process for coating application In: Advanced engineering materials, 8 (7), 635-639, 2006 [DOI: 10.1002/adem.200600054] | Lugscheider, Erich Bobzin, Kirsten Zhao, Lidong Zwick, Jochen Bernt |
[Journal Article] Deposition of aluminium alloy Al12Si by cold spraying In: Advanced engineering materials, 8 (4), 264-267, 2006 [DOI: 10.1002/adem.200500227] | Zhao, Lidong Bobzin, Kirsten He, Dingyong Zwick, Jochen Bernt Ernst, Felix Björn Gustav Lugscheider, Erich |
[Contribution to a conference proceedings, Journal Article] Carbon based tool coatings as an approach for environmentally friendly metal forming processes In: Wear, 260 (3), 287-295, 2006 [DOI: 10.1016/j.wear.2005.04.026] | Klocke, Fritz Maßmann, Thomas Christoph Bobzin, Kirsten Lugscheider, Erich Bagcivan, Nazlim |
[Journal Article] Advanced homogenization strategies in material modeling of thermally sprayed TBCs In: Advanced engineering materials, 8 (7), 663-669, 2006 [DOI: 10.1002/adem.200600046] | Bobzin, Kirsten Lugscheider, Erich Nickel, Reimo Kashko, Tatyana |
[Journal Article] Thermal cycling behaviour of lanthanum zirconate as EB-PVD thermal barrier coating In: Advanced engineering materials, 8 (7), 653-657, 2006 [DOI: 10.1002/adem.200600055] | Bobzin, Kirsten Lugscheider, Erich Bagcivan, Nazlim |
[Journal Article] The influence of hot isostatic pressing on plasma sprayed coatings properties In: Surface & coatings technology, 201 (3/4), 1224-1227, 2006 [DOI: 10.1016/j.surfcoat.2006.01.046] | Abdel-Samad, Abdou Lugscheider, Erich Bobzin, Kirsten Maes, Michael |
[Contribution to a conference proceedings, Journal Article] Relation of hardness and oxygen flow of Al2O3 coatings deposited by reactive bipolar pulsed magnetron sputtering In: Thin solid films, 494 (1/2), 255-262, 2006 [DOI: 10.1016/j.tsf.2005.08.162] | Bobzin, Kirsten Lugscheider, Erich Maes, Michael Pinero, Carmen |
[Journal Article] Integrated approach for the development of advanced, coated gas turbine blades In: Advanced engineering materials, 8 (6), 535-562, 2006 [DOI: 10.1002/adem.200500277] | Herzog, R. Warnken, Nils Steinbach, Ingo Hallstedt, Bengt Walter, C. Müller, Jochen Hajas, David E. Münstermann, Ernst Schneider, Jochen M. Nickel, Reimo Parkot, Daniel Bobzin, Kirsten Lugscheider, Erich Bednarz, P. Trunova, O. Singheiser, Lorenz |
[Contribution to a conference proceedings, Journal Article] A systematic approach to material eligibility for the cold-spray process In: Journal of thermal spray technology : JTST, 14 (1), 125-133, 2005 [DOI: 10.1361/10599630522738] | Vlcek, J. Gimeno, L. Huber, H. Lugscheider, Erich |
[Journal Article] Metallographic investigations of composite structures of aluminium foam with thermally sprayed coatings In: Praktische Metallographie = Practical metallography, 42 (1), 5-14, 2005 | Maurer, Matthias Josef Koch, Dieter Zhao, Lidong Lugscheider, Erich |
[Contribution to a conference proceedings, Journal Article] Superelastic (Cr,Al)N coatings for high end spindle bearings In: Surface & coatings technology, 200.2006 (5/6), 1738-1744, 2005 [DOI: 10.1016/j.surfcoat.2005.08.043] | Brecher, Christian Spachtholz, Guido Bobzin, Kirsten Lugscheider, Erich Knotek, Otto Maes, Michael |
[Journal Article] PVD-Beschichtungen schützen die Kontaktpartner In: Facts - CemCon, 2005 (24), 8-9, 2005 | Brecher, Christian Bobzin, Kirsten Maes, Michael Gold, Peter Werner Kuhn, Marius Bugiel, Christoph |
[Journal Article] Hybridprozesstechnik zur Plasmasynthese temperaturbeständiger Kohlenstoffschichten In: WING : das Jahrbuch, 2005, 2005 | Bobzin, Kirsten Lugscheider, Erich Bagcivan, Nazlim |
[Contribution to a book, Journal Article] Innovative PVD-Beschichtungen für das Thixoforming von Stahl In: Jahrbuch Oberflächentechnik, 61, 2005 | Bobzin, Kirsten Lugscheider, Erich Maes, Michael |
[Journal Article] Plasmalöten von Aluminium- und Magnesiumlegierungen In: Der Praktiker, 97, 118-119, 2005 | Bobzin, Kirsten Lugscheider, Erich Ernst, Felix Björn Gustav Jäger, Doris Rösing, J. |
[Journal Article] Aktuelle Entwicklungstrends in der thermischen Spritztechnik - eine Kurzübersicht In: Schweissen und Schneiden, 57 (4), 137-140, 2005 | Lugscheider, Erich Bobzin, Kirsten Zwick, J. |
[Contribution to a conference proceedings, Journal Article] Established protective tool coatings for difficult machining operations In: Journal of vacuum science & technology / A, Vacuum, surfaces, & films, 24.2006.4, 2005 | Bobzin, Kirsten Maes, Michael Pinero, Carmen |
[Journal Article] Mikroplasmaspritzen ein Verfahren für kleine Bauteile In: Schweissen und Schneiden, 57 (10), 564-568, 2005 | Bobzin, Kirsten Lugscheider, Erich Zwick, J. Zhao, Lidong |
[Journal Article] (C,Al)N Beschichtungen für Hoschgeschwindigkeitsspindellager, Proceedings: GfT- 46. Tribologiefachtagung 26.-28.09.05, Göttingen Vortrag 22, Band I In: Tribologie und Schmierungstechnik, 53 (3/06), 17-21, 2005 | Bobzin, Kirsten Lugscheider, Erich Maes, Michael |
[Contribution to a conference proceedings, Journal Article] Investigation of the stability of tetragonal PVD zirconia coatings without dopants In: International journal of adhesion & adhesives, 27.2007 (5 : Special issue), 2005 | Lugscheider, Erich Bobzin, Kirsten Maes, Michael Immich, Philipp |
[Contribution to a conference proceedings, Journal Article] Method of resolution to inhibit the growth of alumina in the intermetallic NiAl FG 75 alloy to increase TBC lifetime In: Surface & coatings technology, 200.2005 (5/6), 2005 | Bobzin, Kirsten Lugscheider, Erich Maes, Michael Lackner, Kristijan |
[Journal Article] Einfluss von Silizium-Dotierungen auf das Reibverhalten von kohlenstoffbasierten PVD-Beschichtungen In: Tribologie und Schmierungstechnik, 52 (6), 37-41, 2005 | Lugscheider, Erich Bobzin, Kirsten Bagcivan, Nazlim |
[Journal Article] Laser drilled microholes in zirconia coated surfaces using two variants to implement the effusion cooling of first stage turbine blades In: Advanced engineering materials, 7 (3), 145-152, 2005 [DOI: 10.1002/adem.200400148] | Lugscheider, Erich Bobzin, Kirsten Maes, Michael Lackner, K. Poprawe, Reinhart Kreutz, E. W. Willach, J. |
[Journal Article] The effect of pulse sequence modulation and pulse energy on structural coating properties and coating composition In: Surface & coatings technology, 200 (5/6), 1560-1565, 2005 [DOI: 10.1016/j.surfcoat.2005.08.064] | Bobzin, Kirsten Lugscheider, Erich Maes, Michael |
[Contribution to a conference proceedings, Journal Article] Monte Carlo simulation of the PVD transport process for alloys In: Surface & coatings technology, 200.2005 (1/4), 913-915, 2005 [DOI: 10.1016/j.surfcoat.2005.02.141] | Lugscheider, Erich Bobzin, Kirsten Papenfuß-Janzen, Nobert Parkot, Daniel |
[Contribution to a conference proceedings, Journal Article] Advancement in low melting solder deposition by pulsed magnetron sputter-PVD process for microsystemtechnology In: Surface & coatings technology, 200.2005 (1/4), 444-447, 2005 [DOI: 10.1016/j.surfcoat.2005.02.193] | Lugscheider, Erich Bobzin, Kirsten Maes, Michael Ferrara, Stefania Erdle, Anja |
[Journal Article] HVOF spraying of Al 2O 3-dispersion-strengthened NiCr powders In: Surface & coatings technology, 182 (1), 72-77, 2004 [DOI: 10.1016/S0257-8972(03)00874-0] | Zhao, Lidong Zwick, Jochen Bernt Lugscheider, Erich |
[Journal Article] High velocity oxy-fuel thermal spraying of a NiCoCrAlY alloy In: Surface & coatings technology, 179 (2/3), 272-278, 2004 [DOI: 10.1016/S0257-8972(03)00818-1] | Zhao, Lidong Parco, Maria Lugscheider, Erich |
[Journal Article] Characterisation and optimisation of innovative solders for transient liquid phase bonding and active soldering In: Advanced engineering materials, 6 (3), 160-163, 2004 [DOI: 10.1002/adem.200300538] | Lugscheider, Erich Ferrara, S. |
[Contribution to a conference proceedings, Journal Article] Progress and developments in the field of materials for transient liquid phase bonding and active soldering processes In: Microsystem technologies, 10 (3), 233-236, 2004 [DOI: 10.1007/s00542-003-0351-6] | Lugscheider, Erich Ferrara, S. Janssen, H. Reimann, A. Wildpanner, B. |
[Contribution to a conference proceedings, Journal Article] Plasma diagnostics as a tool for the modeling and simulation of sputter processes In: Surface & coatings technology, 177-178, 597-602, 2004 [DOI: 10.1016/j.surfcoat.2003.08.066] | Lugscheider, Erich Papenfuss-Janzen, Norbert |
[Journal Article] The new easyFoam-process and mechanical properties of foam-coating-sandwiches In: Advanced materials, 6 (11), 893-896, 2004 [DOI: 10.1002/adem.200300523] | Maurer, M. Zhao, Lidong Lugscheider, Erich |
[Contribution to a conference proceedings, Journal Article] Neue PVD-Schichtkonzepte für hoch beanspruchte Werkzeuge für umweltverträgliche Fertigungsprozesse In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 35 (10/11), 851-857, 2004 [DOI: 10.1002/mawe.200400804] | Bobzin, Kirsten Lugscheider, Erich Piñero, C. |
[Journal Article] Influence of spray parameters on the particle in-flight properties and the properties of HVOF coating of WC-CoCr In: Wear, 257 (1/2), 41-46, 2004 [DOI: 10.1016/j.wear.2003.07.002] | Zhao, Lidong Maurer, Matthias Josef Fischer, Falko Dicks, Robert Lugscheider, Erich |
[Journal Article] Study of HVOF spraying of WC-CoCr using on-line particle monitoring In: Surface & coatings technology, 185 (2/3), 160-165, 2004 [DOI: 10.1016/j.surfcoat.2003.12.024] | Zhao, Lidong Maurer, Matthias Josef Fischer, Falko Lugscheider, Erich |
[Journal Article] Wear behaviour of Al2O3 dispersion strengthened MCrAlY coating In: Surface & coatings technology, 184 (2/3), 298-306, 2004 [DOI: 10.1016/j.surfcoat.2003.10.055] | Zhao, Lidong Parco, Maria Lugscheider, Erich |
[Contribution to a conference proceedings, Journal Article] Development of a superlattice (Ti,Hf,Cr)N coating for cold metal forming applications In: Surface & coatings technology, 177/178.2004, 616-622, 2004 [DOI: 10.1016/S0257-8972(03)00935-6] | Lugscheider, Erich Bobzin, Kirsten Pinero, Carmen Klocke, Fritz Maßmann, Thomas Christoph |
[Journal Article] Lanthanzirkonat : ein innovatives Wärmedämmschichtmaterial In: Vakuum in Forschung und Praxis : VIP, 16, 170-175, 2004 [DOI: 10.1002/vipr.200400229] | Lugscheider, Erich Bobzin, Kirsten Lackner, Kristijan |
[Journal Article] Modernste PVD-Dünnschichttechnologie erobert neue Märkte In: Jahrbuch Oberflächentechnik, 60, 108-125, 2004 | Lugscheider, Erich Bobzin, Kirsten Maes, Michael |
[Journal Article] Herstellung eines Mikroaktors auf der Basis lasergestützter Strukturierung von PVD-abgeschiedenen Bimetallstrukturen In: Produktion von Leiterplatten und Systemen : PLUS, 6 (5), 2004 | Lugscheider, Erich Bobzin, Kirsten Erdle, Anja Horn, A. Pütz, U. Kreutz, E. W. Poprawa, R. |
[Contribution to a conference proceedings, Journal Article] High-performance chromium aluminium nitride PVD coatings on roller bearings In: Surface & coatings technology, 188/189.2004, 649-654, 2004 [DOI: 10.1016/j.surfcoat.2004.07.030] | Bobzin, Kirsten Lugscheider, Erich Maes, Michael Gold, Peter Werner Loos, J. Kuhn, M. |
[Journal Article] PVD-Niedertemperaturbeschichtung für Bauteile zur Integration tribologischer Funktionen in die Oberfläche In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 35 (10/11), 843-850, 2004 [DOI: 10.1002/mawe.200400803] | Bobzin, Kirsten Lugscheider, Erich Maes, Michael |
[Contribution to a conference proceedings, Journal Article] Plasma diagnostical comparison of the MSIP process of (Ti,Al)N with pulsed and dc power supplies using energy-resolved mass spectroscopy In: Surface & coatings technology, 188/189, 164-167, 2004 [DOI: 10.1016/j.surfcoat.2004.08.011] | Lugscheider, Erich Bobzin, Kirsten Papenfuß-Janzen, Norbert Maes, Michael Parkot, Daniel |
[Contribution to a conference proceedings, Journal Article] Active soft solder deposition by magnetron-sputter-ion-plating (MSIP)-PVD-process In: Thin solid films, 447/448.2004, 327-331, 2004 [DOI: 10.1016/S0040-6090(03)01110-6] | Lugscheider, Erich Bobzin, Kirsten Erdle, Anja |
[Contribution to a conference proceedings, Journal Article] On the coating of polymers : basic investigations In: Thin solid films, 459.2004 (1/2), 313-317, 2004 [DOI: 10.1016/j.tsf.2003.12.134] | Lugscheider, Erich Bobzin, Kirsten Maes, Michael Krämer, Anika |
[Contribution to a book, Journal Article] Characterization of steel thixoforming tool materials by high temperature compression tests In: Steel research international, 75.2004 (8/9), 569-576, 2004 | Kopp, Reiner Shimahara, Hideki Schneider, Jochen M. Kurapov, Denis Telle, Rainer Münstermann, Simon Lugscheider, Erich Abdel-Samad, Abdou Bobzin, Kirsten Maes, Michael |
[Journal Article] Thermal spraying of a nitrogen alloyed austenitic steel In: Thin solid films, 424 (2), 213-218, 2003 [DOI: 10.1016/S0040-6090(02)01047-7] | Zhao, Lidong Maurer, Matthias Josef Lugscheider, Erich |
[Contribution to a conference proceedings, Journal Article] Finite element simulation of a coating formation on a turbine blade during plasma spraying In: Surface & coatings technology, 174-175, 475-481, 2003 [DOI: 10.1016/S0257-8972(03)00331-1] | Lugscheider, Erich Nickel, R. |
[Contribution to a conference proceedings, Journal Article] First results on duplex coatings without intermediate mechanical treatment In: Surface & coatings technology, 174-175, 671-676, 2003 [DOI: 10.1016/S0257-8972(03)00578-4] | Kamminga, J. D. Hoy, R. Janssen, G. C. A. Lugscheider, Erich Maes, M. |
[Contribution to a conference proceedings, Journal Article] Investigation of thermal spraying processes using simulation methods In: Journal of materials processing technology, 26 (2), 217-226, 1991 [DOI: 10.1016/0924-0136(91)90135-2] | Elsing, Rainer Knotek, Otto Balting, U. |
[Journal Article] Oberflächen tunen - PVD/CVD-Dünnschichttechnologie In: Metalloberfläche : mo, 57 (9), 33-37, 2003 | Lugscheider, Erich Bobzin, Kirsten Maes, Michael |
[Journal Article] Erosion- und brandrissmindernde PVD-Hartstoffschichten für Aluminium und Magnesium-Druckgießformen In: International foundry research, 55 (3), 93-97, 2003 | Lugscheider, Erich Bobzin, Kirsten Maes, Michael |
[Contribution to a conference proceedings, Journal Article] New concepts of graded zirconium carbide coatings for components In: Surface & coatings technology, 177/178.2004, 2003 | Lugscheider, Erich Knotek, Otto Bobzin, Kirsten Maes, Michael |
[Contribution to a conference proceedings, Journal Article] Low temperature deposition of CrAlN coatings for the application on machine parts In: Surface & coatings technology, 177/178.2004, 2003 | Lugscheider, Erich Bobzin, Kirsten Maes, Michael |
[Contribution to a conference proceedings, Journal Article] Increasing AlN amount in magnetron sputtered Cr(1-x)Al(x)N PVD-coatings for high temperature applications by means of pulsed power supplies In: Surface & coatings technology, 177/178.2004, 2003 | Lugscheider, Erich Bobzin, Kirsten Maes, Michael |
[Journal Article] Study on atmospheric plasma spraying of Al2O3 using on-line particle monitoring In: Surface & coatings technology, 136/138 (2/3), 258-262, 2003 [DOI: 10.1016/S0257-8972(03)00201-9] | Lugscheider, Erich Zhao, Lidong Seemann, Klaus Fischer, Arne |
[Journal Article] Influence of the spraying processes on the properties of 316L stainless steel coatings In: Surface & coatings technology, 162 (1), 6-10, 2003 [DOI: 10.1016/S0257-8972(02)00560-1] | Lugscheider, Erich Zhao, Lidong |
[Journal Article] The influence of milling parameters on the properties of the milled powders and the resultant coatings In: Surface & coatings technology, 168 (2/3), 179-185, 2003 [DOI: 10.1016/S0257-8972(03)00202-0] | Lugscheider, Erich Zwick, Jochen Bernt Zhao, Lidong |
[Contribution to a conference proceedings, Journal Article] Investigations of mechanical and tribological properties of CrAlN+C thin coatings deposited on cutting tools In: Surface & coatings technology, 174/175.2003, 681-686, 2003 [DOI: 10.1016/S0257-8972(03)00566-8] | Lugscheider, Erich Bobzin, Kirsten Lackner, Kristijan |
[Journal Article] Determination of mechanical properties of electron beam-physical vapor deposition-thermal barrier coatings (EB-PVD-TBCs) by means of nanoindentation and impact testing In: Surface & coatings technology, 163/164, 75-80, 2003 [DOI: 10.1016/S0257-8972(02)00594-7] | Bouzakis, K.-D. Lontos, A. Michailidis, N. Knotek, Otto Lugscheider, Erich Bobzin, Kirsten Etzkorn, Achim Helmut |
[Contribution to a conference proceedings, Journal Article] Solder deposition for transient liquid phase (TLP)-bonding by MSIP-PVD-process In: Surface & coatings technology, 174/175.2003, 704-707, 2003 [DOI: 10.1016/S0257-8972(03)00692-3] | Lugscheider, Erich Bobzin, Kirsten Erdle, Anja |
[Journal Article] Wettability of PVD compound materials by lubricant In: Surface & coatings technology, 165 (1), 51-57, 2003 [DOI: 10.1016/S0257-8972(02)00724-7] | Lugscheider, Erich Bobzin, Kirsten |
[Journal Article] In-flight reactions of metallic particles during thermal spraying In: Advanced engineering materials, 4 (12), 922-924, 2002 [DOI: 10.1002/adem.200290005] | Zhao, Lidong Herbst-Dederichs, C. Lugscheider, Erich |
[Contribution to a conference proceedings, Journal Article] Surface refinement of metal foams In: Advanced engineering materials, 4 (10), 791-797, 2002 [DOI: 10.1002/1527-2648(20021014)4:10<791::AID-ADEM791>3.0.CO;2-Q] | Maurer, Matthias Josef Zhao, Lidong Lugscheider, Erich |
[Journal Article] High-temperature brazing of superalloys and stainless steels with novel ductile Ni-Hf-based filler metals In: Advanced engineering materials, 4 (3), 138-142, 2002 [DOI: 10.1002/1527-2648(200203)4:3<138::AID-ADEM138>3.0.CO;2-Y] | Lugscheider, Erich Humm, S. |
[Journal Article] High velocity oxy-fuel spraying of a NiCoCrAlY and an intermetallic NiAl-TaCr alloy In: Surface & coatings technology, 149 (2/3), 230-235, 2002 [DOI: 10.1016/S0257-8972(01)01444-X] | Zhao, Lidong Lugscheider, Erich |
[Contribution to a conference proceedings, Journal Article] Process and advantage of multicomponent and multilayer PVD coatings In: Surface & coatings technology, 59 (1/3), 14-20, 1993 [DOI: 10.1016/0257-8972(93)90048-S] | Knotek, O. Löffler, Frank Krämer, G. |
[Contribution to a conference proceedings, Journal Article] Ceramic cathodes for arc-physical vapour deposition : development and application In: Surface & coatings technology, 49 (1/3), 263-267, 1991 [DOI: 10.1016/0257-8972(91)90066-6] | Knotek, Otto Löffler, Frank Bohmer, M. Breidenbach, R. Stossel, C. |
[Contribution to a conference proceedings, Journal Article] Amorphous carbon physically vapour deposited coatings In: Surface & coatings technology, 49 (1/3), 370-373, 1991 [DOI: 10.1016/0257-8972(91)90085-B] | Knotek, Otto Löffler, Frank Brand, J. Burgmer, W. |
[Journal Article] PVD-beschichtete Zerspanwerkzeuge für moderne Zerspanoperationen (Teil 1) In: Stahl, 2002 (3), 45-47, 2002 | Lugscheider, Erich Bobzin, Kirsten Hornig, Thomas Colmenares, C. |
[Journal Article] PVD-beschichtete Zerspanwerkzeuge für moderne Zerspanoperationen (Teil 2) In: Stahl, 2002 (4), 45-47, 2002 | Lugscheider, Erich Bobzin, Kirsten Hornig, Thomas Colmenares, C. |
[Journal Article] Übertragung tribologischer Funktionen der Schmierstoffe auf die Werkstoffoberfläche mittels PVD-Technologie In: Tribologie und Schmierungstechnik, 49 (1), 16-20, 2002 | Lugscheider, Erich Bobzin, Kirsten |
[Contribution to a book, Journal Article] Wenn Schichten laufen wie geschmiert... : Moderne PVD-Schichten ersetzen umweltgefährdende Schmierstoff-Additive In: RWTH-Themen : Berichte aus der Rheinisch-Westfälischen Technischen Hochschule Aachen, 2002 (1), 81-83, 2002 | Beckers, Manfred Lugscheider, Erich Bobzin, Kirsten Hornig, Th. |
[Journal Article] Das tribologische Verhalten von neu entwickelten PVD-Schichten für die umweltverträgliche Kaltumformung In: Tribologie und Schmierungstechnik, 49 (6), 19-25, 2002 | Lugscheider, Erich Bobzin, Kirsten Beckers, M. Colmenares, C. Klocke, F. Raedt, H.-W. |
[Contribution to a conference proceedings, Journal Article] Energy resolved ion mass spectroscopy of (Ti,Al)N hard coatings deposited by bipolar pulsed magnetron sputtering In: Surface & coatings technology, 174/175, 2002 | Lugscheider, Erich Bobzin, Kirsten Papenfuß-Janzen, Norbert Erkens, Georg Cremer, R. Rambadt, S. |
[Journal Article] Reactive plasma spraying of TiAl6V4 alloy In: Wear, 253 (11/12), 1214-1218, 2002 [DOI: 10.1016/S0043-1648(02)00246-6] | Lugscheider, Erich Zhao, Lidong |
[Journal Article] Berechnung von Wärmebehandlungsprozessen - Welche Möglichkeiten hat der Praktiker? Teil I: Temperaturfelder und verwandte Eigenschaften wie Gefüge und Härte In: Der Wärmebehandlungsmarkt : Daten, Fakten, Angebote / Dr. Sommer Werkstofftechnik GmbH, 2002 (3), 5-8, 2002 | Elsing, Rainer |
[Journal Article] Graded EB-PVD-thermal barrier coatings produced by powder evaporation In: Advanced engineering materials, 4 (12), 919-922, 2002 [DOI: 10.1002/adem.200290004] | Lugscheider, Erich Bobzin, Kirsten Etzkorn, Achim Helmut Syrokas, G. Siry, C. W. |
[Contribution to a conference proceedings, Journal Article] Investigation of the residual stresses and mechanical properties of (Cr,Al)N arc PVD coatings used for semi-solid metal (SSM) forming dies In: Thin solid films, 420/421, 318-323, 2002 [DOI: 10.1016/S0040-6090(02)00831-3] | Lugscheider, Erich Bobzin, Kirsten Hornig, Thomas Maes, Michael |
[Journal Article] Testing and design of tool coatings with properties adapted to the use of biodegradable cutting fluids In: CIRP annals : manufacturing technology, 50 (1), 57-60, 2001 [DOI: 10.1016/S0007-8506(07)62070-8] | Klocke, Fritz Krieg, T. Lugscheider, Erich Bobzin, Kirsten |
[Journal Article] PVD-Beschichtungen lassen Kunststoffe kalt In: Metalloberfläche : mo, 55 (10), 34-37, 2001 | Lugscheider, Erich Bobzin, Kirsten Hornig, Thomas Beckers, M. |
[Contribution to a conference proceedings, Journal Article] Deposition of solder for micro-joining on M.E.M.S. components by means of magnetron sputtering In: Surface & coatings technology, 142/144, 813-816, 2001 [DOI: 10.1016/S0257-8972(01)01182-3] | Lugscheider, Erich Bobzin, Kirsten Lake, Michael K. |
[Journal Article] Atomistic simulation of surface evolution during PVD coating processes In: Surface & coatings technology, 142/144, 923-927, 2001 [DOI: 10.1016/S0257-8972(01)01316-0] | Lugscheider, Erich Hayn, G. v. |
[Journal Article] Thermal spraying of a high nitrogen duplex austenitic-ferritic steel In: Surface & coatings technology, 141 (2/3), 208-215, 2001 [DOI: 10.1016/S0257-8972(01)01233-6] | Lugscheider, Erich Zhao, Lidong Fischer, A. Reimann, A. |
[Journal Article] Systematische Entwicklung gradierter ZrC und HfC Schichten für tribologische Anwendungen am Beispiel von hydraulischen Komponenten In: Tribologie und Schmierungstechnik, 48 (1), 2001 | Lugscheider, Erich Bobzin, Kirsten Burckhardt, M. Murrenhoff, Hubertus van Bebber, David |
[Journal Article] Metall-Kohlenstoffschichten (ZrCg und HfCg) für den Einsatz in hydraulischen Komponenten In: O + P : Fluidtechnik für den Maschinen- und Anlagenbau, 45 (5), 361-, 2001 | Murrenhoff, Hubertus van Bebber, David Lugscheider, Erich Bobzin, Kirsten Burckhardt, M. |
[Journal Article] Widening the usability of yttria stabilised zirconia by advanced cooling technology In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 32 (8), 660-664, 2001 [DOI: 10.1002/1521-4052(200108)32:8<660::AID-MAWE660>3.0.CO;2-G] | Lugscheider, Erich Bobzin, Kirsten Etzkorn, Achim Helmut |
[Journal Article] Characteristic curves of voltage and current phase generation and properties of tungsten- and vanadium-oxides deposited by reactive d.c.-MSIP-PVD-process for self-lubricating applications In: Surface & coatings technology, 142/144, 137-142, 2001 [DOI: 10.1016/S0257-8972(01)01318-4] | Lugscheider, Erich Knotek, Otto Bärwulf, Stephan Bobzin, Kirsten |
[Journal Article] The influence on surface free energy of PVD-coatings In: Surface & coatings technology, 142/144, 755-760, 2001 [DOI: 10.1016/S0257-8972(01)01315-9] | Lugscheider, Erich Bobzin, Kirsten |
[Journal Article] Mechanical properties of EB-PVD-thermal barrier coatings by nanoindentation In: Surface & coatings technology, 138 (1), 9-13, 2001 [DOI: 10.1016/S0257-8972(00)01147-6] | Lugscheider, Erich Bobzin, Kirsten Bärwulf, Stephan Etzkorn, Achim Helmut |
[Journal Article] A comparative study on thermally sprayed alumina based ceramic coatings In: Journal of materials science : JMS, 35 (12), 3127-3130, 2000 [DOI: 10.1023/A:1004824104162] | Abdel-Samad, A. A. El-Bahloul, A. M. Lugscheider, Erich Rassoul, S. A. |
[Contribution to a conference proceedings, Journal Article] Erhöhung und Charakterisierung der Festigkeit von Metallschäumen für lasttragende Anwendungen durch thermisch gespritzte Verbundstrukturen In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 31 (6), 523-526, 2000 [DOI: 10.1002/1521-4052(200006)31:6<523::AID-MAWE523>3.0.CO;2-%23] | Maurer, Matthias Josef Lugscheider, Erich |
[Journal Article] Tribological behaviour at room temperature and at 550°C of TiC-based plasma sprayed coatings in fretting gross slip conditions In: Wear, 244 (1/2), 165-179, 2000 [DOI: 10.1016/S0043-1648(00)00455-5] | Economou, S. de Bonte, M. Celis, J. P. Smith, R. W. Lugscheider, Erich |
[Journal Article] Electron beam-physical vapor deposition - thermal barrier coatings on laser drilled surfaces for transpiration cooling In: Surface & coatings technology, 133/134, 49-53, 2000 [DOI: 10.1016/S0257-8972(00)00872-0] | Lugscheider, Erich Bobzin, Kirsten Etzkorn, Achim Helmut Horn, Alexander Weichenhain, Ruth Kreutz, Ernst Wolfgang Poprawe, Reinhart |
[Journal Article] Functional metal based coatings on ceramic substrates In: Surface & coatings technology, 132, 222-276, 2000 [DOI: 10.1016/S0257-8972(00)00868-9] | Löffler, Frank |
[Journal Article] Reactive plasma spraying of titanium In: Advanced engineering materials, 2 (5), 281-284, 2000 [DOI: 10.1002/(SICI)1527-2648(200005)2:5<281::AID-ADEM281>3.3.CO;2-T] | Lugscheider, Erich Zhao, Lidong Fischer, Andreas |
[Journal Article] Benetzbarkeit von PVD-Werkstoffverbunden durch Schmierstoffe In: Tribologie und Schmierungstechnik, 48 (2), 2000 | Lugscheider, Erich Bobzin, Kirsten |
[Contribution to a conference proceedings, Journal Article] Tool coating deposited by PVD-processes for the protection against corrosion and wear of the aluminium thixoforming-process In: Thin solid films, 377/378, 2000 | Lugscheider, Erich Knotek, Otto Wolff, C. Bärwulf, Stephan |
[Journal Article] Brazing of silicon nitride with reactive filler metals In: Science and engineering of composite materials, 7 (3), 107-112, 2000 | Lugscheider, Erich Buschke, I. Indacochea, J. E. Tillmann, W. Trehan, V. Trickey, S. |
[Journal Article] On the oxidation of Ni-23Co-17Cr-12Al-0.5Y-Alloy serving as bond coat in thermal barrier coatings In: High temperature material processes, 4 (3), 339-350, 2000 | Haugsrud, R. Kvernes, I. Lugscheider, Erich |
[Journal Article] PVD-Dünnschichttechnologie für maßgeschneiderte Oberflächen In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 91 (9), 2580-2585, 2000 | Lugscheider, Erich Bobzin, Kirsten Bärwulf, Stephan |
[Journal Article] Rockwell-Härteprüfmaschinen kalibrieren In: Materialprüfung : MP, 42, 2000 | Löffler, F. |
[Journal Article] Lotlegierungen und Lötverfahren zum flussmittelfreien Löten schwer benetzbarer Werkstoffe In: Schweissen und Schneiden, 52 (8), 454-460, 2000 | Hillen, Frank Pickart-Castillo, Darmar Rass, I. J. Lugscheider, Erich |
[Journal Article] Simulation of heat transfer and residual stresses in plasma spray coating In: News of Belarusian Academy of Science / Series of physic-technical science, 2000 (1), 134-141, 2000 | Kuzmenkov, A. Kundas, S. Gurevich, V. Lugscheider, Erich Eritt, U. |
[Journal Article] Computer modelling of the plasma spraying process In: The Paton welding journal, 12, 40-51, 2000 | Lugscheider, Erich Eritt, U. Krivtsun, I. V. Muzhichenko, A. F. Yu, S. |
[Journal Article] Feinbleche aus verzinktem Stahl ohne Flussmittel hartlöten In: Der Praktiker, 52 (3), 94-96, 2000 | Lugscheider, Erich Schlimbach, K. |
[Journal Article] Durch Pulver-Plasmaauftragschweißen Verschleißverhalten von Aluminiumlegierungen verbessern In: Der Praktiker, 52 (4), 142-146, 2000 | Lugscheider, Erich Dilthey, Ulrich Kabatnik, Lars Langer, G. Schlimbach, K. |
[Journal Article] PVD hard coatings protecting the surface of thixoforming tools In: Advanced engineering materials, 2 (1/2), 33-37, 2000 [DOI: 10.1002/(SICI)1527-2648(200002)2:1/2<33::AID-ADEM33>3.0.CO;2-J] | Lugscheider, Erich Bobzin, Kirsten Bärwulf, Stephan Hornig, T. |
[Journal Article] Durch Pulver-Plasmaauftragschweißen Verschleißverhalten von Aluminiumlegierungen verbessert In: Der Praktiker, 52 (4), 142-148, 2000 | Dilthey, Ulrich Kabatnik, Lars Lugscheider, Erich Schlimbach, K. |
[Journal Article] Tribological properties, phase generation and high temperature phase stability of tungsten- and vanadium-oxides deposited by reactive MSIP-PVD process for innovative lubrication applications In: Surface & coatings technology, 133/134 (1/3), 362-368, 2000 [DOI: 10.1016/S0257-8972(00)00963-4] | Lugscheider, Erich Knotek, Otto Bobzin, Kirsten Bärwulf, Stephan |
[Journal Article] Oxidation characteristics and surface energy of chromium-based hardcoatings for use in semisolid forming tools In: Surface & coatings technology, 133/134, 540-547, 2000 | Lugscheider, Erich Bobzin, Kirsten Bärwulf, Stephan Hornig, T. |
[Journal Article] Möglichkeiten zur Steigerung der Oberflächenfestigkeit bei Aluminiumlegierungen mit Plasma-Pulver-Schweißverfahren In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 30 (11), 697-702, 1999 [DOI: 10.1002/(SICI)1521-4052(199911)30:11<697::AID-MAWE697>3.3.CO;2-D] | Dilthey, Ulrich Kabatnik, Lars Lugscheider, Erich Schlimbach, K. Langer, G. |
[Contribution to a conference proceedings, Journal Article] Investigation of the mechanical and structural properties of Ti-Hf-C-N are PVD coatings In: Surface & coatings technology, 116, 239-243, 1999 [DOI: 10.1016/S0257-8972(99)00115-2] | Lugscheider, E. Knotek, O. Zimmermann, H. Hellmann, S. |
[Contribution to a conference proceedings, Journal Article] Magnetron sputtered titanium nitride thin films on thermoplastic polymers In: Surface & coatings technology, 116, 1172-1178, 1999 [DOI: 10.1016/S0257-8972(99)00157-7] | Lugscheider, E. Bärwulf, S. Riester, M. Hilgers, H. |
[Journal Article] Effect of thermal aging on the erosion resistance of air plasma sprayes zirconia thermal barrier coating In: Surface & coatings technology, 113 (3), 278-285, 1999 [DOI: 10.1016/S0257-8972(99)00002-X] | Lugscheider, Erich Remer, P. Janos, B. Z. |
[Contribution to a conference proceedings, Journal Article] Superhard PVD coatings in the B-N-C triangle In: International journal of refractory and hard metals : R & HM, 17 (1/3), 157-162, 1999 [DOI: 10.1016/S0263-4368(98)00066-3] | Lugscheider, Erich Knotek, Otto Syri, C. W. |
[Journal Article] Simulation of the film growth and film-substrate mixing during the sputter deposition process In: Surface & coatings technology, 116/119, 568-572, 1999 | Lugscheider, Erich Hayn, G. v. |
[Journal Article] Morphology of sputtered titanium nitride thin films on thermoplastic polymers In: Surface & coatings technology, 116/119, 1001-1005, 1999 | Lugscheider, Erich Riester, M. Bärwulf, Stephan Hilgers, H. |
[Journal Article] PVD-hard coated reamers in lubricant - free cutting In: Surface & coatings technology, 112, 146-151, 1999 [DOI: 10.1016/S0257-8972(98)00775-0] | Lugscheider, Erich Knotek, Otto Barimani, Cyrus Leyendecker, T. Lemmer, O. Wenke, R. Wenke, R. |
[Journal Article] Properties of tungsten and vanadium oxides deposited by MSIP-PVD process for self-lubricating applications In: Surface & coatings technology, 120/121, 458-464, 1999 | Lugscheider, Erich Barimani, Cyrus Bärwulf, Stephan |
[Journal Article] Magnetron sputtered titanium nitride thin films on thermoplastic polymeres In: Surface & coatings technology, 116/119, 1172-1178, 1999 | Lugscheider, Erich Bärwulf, Stephan Riester, M. Hilgers, H. |
[Journal Article] Entwicklung einer Technologie zum flußmittelfreien Löten verzinkten Stahls In: Schweissen und Schneiden, 52 (4), 1999 | Lugscheider, Erich Schlimbach, K. |
[Journal Article] Optical emission spectroscopy studies of titanium nitride sputtering on thermoplastic polymers In: Surface & coatings technology, 116/119, 981-985, 1999 [DOI: 10.1016/S0257-8972(99)00214-5] | Lugscheider, Erich Neuhäuser, M. Bärwulf, Stephan Hilgers, H. Riester, M. |
[Journal Article] Composition of the interface region of sputtered titanium nitride thin films on thermoplastic polymers In: Surface & coatings technology, 116/119, 1179-1182, 1999 | Lugscheider, Erich Riester, M. Bärwulf, Stephan Hilgers, H. |
[Journal Article] Investigation of the mechanical and structural properties of Ti-Hf-C-N arc PVD coatings In: Surface & coatings technology, 116/119, 1999 | Lugscheider, Erich Knotek, Otto Zimmermann, H. Hellmann, S. |
[Journal Article] Synthetische Ester und PVD-beschichtete Bauteile als Elemente umweltverträglicher Tribosysteme In: Tribologie und Schmierungstechnik, 46 (10), 1999 | Murrenhoff, Hubertus Remmelmann, Andreas Lugscheider, Erich Bobzin, Kirsten |
[Journal Article] Investigations of the mechanical and structural properties of Ti-Hf-C-N Arc PVD coatings In: Surface & coatings technology, 116/119, 239-243, 1999 | Lugscheider, Erich Knotek, Otto Zimmermann, H. Hellmann, S. |
[Journal Article] Herstellung und Eigenschaftsbestimmung dünner Auftraglotschichten In: Schweissen und Schneiden, 51 (5), 1999 | Lugscheider, Erich |
[Journal Article] Structure and properties of PVD-coatings by means of impact tester In: Surface & coatings technology, 116/119, 141-146, 1999 | Lugscheider, Erich Knotek, Otto Wolff, C. Bärwulf, Stephan |
[Journal Article] The effect of PVD layer constitution on surface free energy In: Thin solid films, 355/356 (1), 367-373, 1999 [DOI: 10.1016/S0040-6090(99)00543-X] | Lugscheider, Erich Bobzin, Kirsten Möller, M. |
[Contribution to a conference proceedings, Journal Article] Parameter studies on high-velocity oxy-fuel spraying of MCrAlY coatings In: Surface & coatings technology, 108 (1/3), 16-23, 1998 [DOI: 10.1016/S0257-8972(98)00630-6] | Lugscheider, Erich Herbst-Dederichs, Christian Zhao, Lidong |
[Contribution to a conference proceedings, Journal Article] Corrosion tests of PVD coatings with die lubricant used for Al high-pressure die-casting dies In: Surface & coatings technology, 108 (1/3), 408-412, 1998 [DOI: 10.1016/S0257-8972(98)00624-0] | Lugscheider, E. Barimani, C. Guerreiro, S. Bobzin, Kirsten |
[Journal Article] Beschichtungen lassen Werkzeuge kalt In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 29 (9), 525-536, 1998 [DOI: 10.1002/mawe.19980290911] | Lugscheider, E. Knotek, O. Konig, W. Stock, H. R. Hellman, S. Zimmermann, H. Lake, M. K. Fritsch, R. Seidel, F. |
[Journal Article] Innenbeschichtung von Al-Motorblöcken mittels PVD-Technik In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 29 (12), 720-725, 1998 [DOI: 10.1002/mawe.19980291207] | Lugscheider, E. Wolff, C. |
[Journal Article] Plasma-Pulverauftragschweißen - Vergleich von Standard- und Hochleistungsprozeß In: Schweissen und Schneiden, 50 (2), 96-101, 1998 | Lugscheider, Erich Langer, G. |
[Journal Article] Simulation von Gleitverschleiß In: Metall, 52, 643-651, 1998 | Peterseim, J. Elsing, R. Deuerler, F. |
[Journal Article] Das Interview In: Schweissen und Schneiden, 50, 332-333, 1998 | Lugscheider, E. |
[Contribution to a conference proceedings, Journal Article] Parameter studies on high-velocity oxy-fuel spraying of MCrAIY coatings In: Thin solid films, ..., 1998 | Lugscheider, E. Zhao, Lidong Herbst, C. |
[Journal Article] Parameter studies on high-velocity oxy-fuel spraying of MCrAIY coatings In: Surface & coatings technology, 108/109, 16-23, 1998 | Lugscheider, E. Zhao, Lidong Herbst, C. |
[Contribution to a conference proceedings, Journal Article] Magnetronsputtered hard material coatings on thermoplastic polymers for clean room applications In: Thin solid films, ..., 1998 | Lugscheider, Erich Bärwulf, Stephan Barimani, Cyrus Riester, M. Hilgers, H. |
[Contribution to a conference proceedings, Journal Article] Investigation of new arc PVD coatings in the system Ti-Hf-C-N In: Thin solid films, ..., 145-145, 1998 | Lugscheider, E. Knotek, O. Zimmermann, H. Stricker, S. |
[Contribution to a conference proceedings, Journal Article] Corrosion tests of PVD coatings with die dressing used for Al high-pressure die-casting dies In: Thin solid films, ..., 1998 | Lugscheider, Erich Barimani, Cyrus Guerreiro, S. Bobzin, Kirsten |
[Journal Article] Vergleich verschiedener Meßmethoden zur Bestimmung der Partikelgröße von Pulvern zum Plasmaspritzen In: Schweissen und Schneiden, 50, 724-731, 1998 | Lugscheider, E. Suk, H.-G. Lee, H.-K. |
[Journal Article] Beschichtungstechnologien entwickeln sich mit den Anforderungen: Über den Masseneinsatz entscheidet ein konsequent durchgeführtes Qualitätsmanagement In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 7 (2), 12-13, 1998 | Lugscheider, E. |
[Journal Article] Analysis of a-BxCy:Hz coatings with IBA techniques In: Nuclear instruments & methods in physics research / Section B, Beam interactions with materials and atoms, 136/138, 258-262, 1998 | Lugscheider, Erich Giorginis, G. Persson, L. Hult, M. Siry, C. W. Crametz, A. |
[Journal Article] Innenbeschichtung von Aluminium Motorblöcken mittels PVD-Technik - Teil 1 In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 89 (2), 40-42, 1998 | Lugscheider, Erich Wolff, C. |
[Journal Article] Processing, structure and tribological behaviour of TiC-reinforced plasma sprayed coatings In: Wear, 220 (1), 34-50, 1998 [DOI: 10.1016/S0043-1648(98)00237-3] | Economou, S. de Bonte, Marc Celis, Jean-Pierre Smith, R. W. Lugscheider, Erich |
[Journal Article] Plasma-arc powder surfacing - comparison of standard and high-productivity processes In: Schweissen und Schneiden, 50, E28-E31, 1998 | Lugscheider, Erich Langer, G. |
[Contribution to a book, Journal Article] Wie High-Tech Beschichtungen laufen lernen : Oberflächenmodifikation an Bauteilen für die Medizintechnik In: RWTH-Themen : Berichte aus der Rheinisch-Westfälischen Technischen Hochschule Aachen, 1998, 40-42, 1998 | Kyeck, Sascha Lake, Mark Lugscheider, Erich |
[Journal Article] High-speed flame-sprayed chromium coatings for wear and corrosion protection In: Schweissen und Schneiden, 50, E36-E39, 1998 | Lugscheider, Erich Reymann, H. |
[Journal Article] Ceramic thermal barrier coatings deposited with the electron beam-physical vapour deposition technique In: Surface & coatings technology, 98 (1/3), 1221-1227, 1998 | Lugscheider, Erich Barimani, Cyrus Döpper, G. |
[Journal Article] Hochgeschwindigkeitsflammgespritzte Chromschichten zum Verschleiß- und Korrosionsschutz In: Schweissen und Schneiden, 50 (1), 44-47, 1998 | Lugscheider, Erich Reymann, H. |
[Journal Article] Possibilities and limits of the characterization of wear resistant PVD coatings by photothermal spectroscopy In: Surface & coatings technology, 98 (1/3), 971-975, 1998 [DOI: 10.1016/S0257-8972(97)00308-3] | Hayn, G. v. Knotek, O. Lugscheider, Erich Zimmermann, H. Zimmermann, H. |
[Journal Article] (Cr:Al)N coatings deposited by cathodic vacuum ARC evaporation In: Surface & coatings technology, 98 (1/3), 1233-1239, 1998 [DOI: 10.1016/S0257-8972(97)00238-7] | Lugscheider, Erich Vetter, J. Guerreiro, S. |
[Journal Article] Heat-resistant active brazing of silicon-nitride. Part 2: Metallurgical characterization of the braze joints In: Welding journal, 77 (Suppl.), 103-109, 1998 | Lugscheider, Erich Tillmann, W. Schlimbach, K. Manter, C. Indacochea, C. A. |
[Journal Article] Comparison of different measuring methods for the determination of the particle size of powders for plasma spraying In: Schweissen und Schneiden, 50, E219-E222, 1998 | Lugscheider, Erich Suk, H.-G. Lee, H.-K. |
[Journal Article] On the thermoelectric performance of plasma spray-formed iron disilicide In: Journal of materials science / Letters, 17, 1487-1490, 1998 | Lugscheider, Erich Schilz, J. Müller, E. Schakenberg, K. Ernst, H. Kaysser, W. A. Langer, G. |
[Journal Article] Wear and cutting performance of coated microdrills In: Surface & coatings technology, 107, 191-196, 1998 | Löffler, F. |
[Journal Article] Corrosion tests of PVD coatings with die dressing used for Al high-pressure die-casting dies In: Surface & coatings technology, 108/109, 408-412, 1998 | Lugscheider, Erich Barimani, Cyrus Guerreiro, S. Bobzin, Kirsten |
[Journal Article] Magnetron-sputtered hard material coatings on thermoplastic polymers for clean room applications In: Surface & coatings technology, 108/109, 398-402, 1998 | Lugscheider, Erich Bärwulf, Stephan Barimani, Cyrus Riester, C. Hilgers, H. |
[Contribution to a conference proceedings, Journal Article] Investigations on hard coated reamers in different lubricant free cutting operations In: Surface & coatings technology, 90 (1/2), 172-177, 1997 [DOI: 10.1016/S0257-8972(96)03114-3] | Lugscheider, Erich Knotek, O. Barimani, C. Leyendecker, T. Lemmer, O. Wenke, R. |
[Journal Article] Induktives Auftragslöten von Verschleißschutzschichtenim kontinuierlichn Verfahrbetrieb In: Schweissen und Schneiden, 49 (6), 356-358, 1997 | Lugscheider, Erich Schmoor, H. |
[Journal Article] Heat-resistant active brazing of silicon-nitride. P. 1: Mechanical evaluation of braze joints - a new class of palladium-based filler metals that wet to ceramics is tested for joint strenght and oxidation resistance In: Welding journal, 76 (8), 300-304, 1997 | Tillmann, W. Schlimbach, K. Manter, C. Indacochea, J. E. Lugscheider, Erich |
[Journal Article] PVD coatings for lubricant-free tribological applications In: Wear, 209, 101-105, 1997 | Knotek, O. Lugscheider, Erich Barimani, Cyrus Möller, M. |
[Journal Article] Development and characterization of joining techniques for dispersion-strenghtened alumina In: Welding journal, 76 (9), 349-355, 1997 | Lugscheider, Erich Burger, W. Broich, U. |
[Journal Article] Fügen und Beschichten in der Produktion der Zukunft - Untersuchung von acht deutschen Forschungsinstituten innerhalb des Rahmenprojekts Produktion 2000 In: Der Praktiker, 49 (11), 516-520, 1997 | Lugscheider, Erich Kortenbruck, G. von Hofe, D. |
[Journal Article] Structure and properties of PVD TiB2-Coatings In: Journal of solid state chemistry, 133, 117-121, 1997 | Knotek, Otto Lugscheider, Erich Barimani, Cyrus Möller, M. |
[Journal Article] New materials increase applications for brazing - P.I: Process considerations, P.II: Industrial heating In: The journal of thermal technology, 1997, Dez.-Dez., 1997 | Smith, R. Lugscheider, Erich |
[Journal Article] Continous inductive hard-surface brazing of wear-resisting layers In: Welding and cutting, 49 (6), E93-E95, 1997 | Lugscheider, Erich Schmoor, H. |
[Journal Article] Continious inductive hard-surface brazing of wear-resisting layers In: Schweissen und Schneiden, 49 (6), E 93, 1997 | Lugscheider, Erich Schmoor, H. |
[Journal Article] Fügen und Beschichten in der Produktion der Zukunft In: Der Praktiker, 49 (11), 516-516, 1997 | Lugscheider, Erich Kortenbruck, G. von Hofe, D. |
[Journal Article] Reactive plasma spraying of coatings containing in situ synthezised titanium hard phases In: International journal of refractory and hard metals : R & HM, 15 (5/6), 311-315, 1997 | Lugscheider, Erich Jungklaus, H. Zhao, Lidong Reymann, H. |
[Journal Article] Entwicklung und Anwendung von PVD-Schichten zur Verschleißverringerung von Druckgießformen In: Giesserei : die Zeitschrift für Technik, Innovation und Management, 84 (23), 17-23, 1997 | Lugscheider, Erich Barimani, Cyrus Guerreiro, S. |
[Journal Article] Tribological properties of B—C thin films deposited by magnetron-sputter-ion plating method In: Surface & coatings technology, 91 (3), 167-173, 1997 [DOI: 10.1016/S0257-8972(96)03105-2] | Lugscheider, Erich Knotek, Otto Siry, C. W. |
[Contribution to a book, Contribution to a conference proceedings, Journal Article] Arc PVD-coated cutting tools for modern machining applications In: Thin solid films, 308/309, 1997 | Lugscheider, Erich Knotek, Otto Barimani, Cyrus Zimmermann, H. |
[Journal Article] Superstöchiometric PVD carbidic and carbonitridic coatings In: Materials science & engineering / A, Structural materials: properties, microstructure and processing, 109, 1996 | Knotek, O. Lugscheider, Erich Löffler, Frank Bosserhoff, B. |
[Journal Article] Flammspritzen mit nachfolgendem Einschmelzen einer NiCrBSi-Legierung auf vergüteten Stählen In: Schweissen und Schneiden, 48 (2), 116-125, 1996 | Matthes, K.-J. Weichbrodt, K.-H. Lanzendörfer, G. Lugscheider, E. Nyland, A. Sicking, R. |
[Journal Article] Mechanical properties of high-temperature brazed titanium materials In: International journal of fatigue, 18 (6), 418-418, 1996 | Lugscheider, Erich Broich, U. Weld, J. |
[Journal Article] Superstoichiometric PVD carbide coatings In: Materials science & engineering / A, Structural materials: properties, microstructure and processing, 209 (1/2), 394-398, 1996 | Lugscheider, Erich Knotek, Otto Löffler, Frank Bosserhoff, B. Schmitz, S. |
[Journal Article] Financiering binnen de EU van onderzoeksprogramma's toegespitst op duitsland In: Materiaalkunde Nieuws, 1996 (4/April), 1996 | Lugscheider, Erich Krugers, J.-P. Ladru, F. |
[Journal Article] Kinetic and microstructural aspects of the reaction layer at ceramic/metal braze joints In: Journal of materials science : JMS, 31 (2), 445-452, 1996 | Xu, R. Lugscheider, Erich Indacochea, J. E. Tillmann, W. |
[Journal Article] Characterization of thermal sprayed bioactive coatings In: Colloids and surfaces / B, Biointerfaces, 6 (1), 7 S., 1996 | Lugscheider, Erich Knepper, M. Nyland, A. |
[Journal Article] PVD coatings for luricant-free tribological applications In: Wear, 209, 101-105, 1996 | Lugscheider, Erich Knotek, Otto Barimani, Cyrus Möller, M. |
[Journal Article] Investigation of thermophysical properties of AIP coated cutting tools for dry machining In: Surface & coatings technology, 86/87 (2), 803-808, 1996 | Lugscheider, Erich Geiler, H. D. Lake, M. Zimmermann, H. |
[Journal Article] Strength and microstructure of brazed cemented carbide and silicon nitride joints In: Journal of materials processing technology, 58 (1), 13-23, 1996 [DOI: 10.1016/0924-0136(95)02103-5] | Lugscheider, Erich Martens, L. Tillmann, W. Ziegler, G. |
[Journal Article] Modeling of the APS plasma spray process In: Computational materials science, 7 (1/2), 109-114, 1996 | Lugscheider, Erich Barimani, Cyrus Eckert, P. Eritt, U. |
[Journal Article] Simulation of the deposition process in PVD-technology In: Computational materials science, 7 (1/2), 154-158, 1996 [DOI: 10.1016/S0927-0256(96)00074-2] | Lugscheider, Erich Knotek, Otto Barimani, Cyrus Eckert, P. Hayn, G. |
[Journal Article] Sliding wear behaviour of thermally sprayed 75/25 Cr3C2/NiCr wear resistant coatings In: Wear, 198, 251-266, 1996 [DOI: 10.1016/0043-1648(96)06983-9] | Mohanty, M. Smith, R. W. de Bonte, Marc Celis, Jean-Pierre Lugscheider, Erich |
[Journal Article] Comparison of the structure of PVD thin films deposited with different deposition energies In: Surface & coatings technology, 86/87 (1), 177-183, 1996 | Lugscheider, Erich Barimani, Cyrus Wolff, C. Guerreiro, S. Döpper, G. |
[Journal Article] Wirtschaftlichkeitsanalyse modernener Beschichtungsverfahren anhand ausgewählter Anwendungsbeispiele In: Stahl, 1996 (4), 45-48, 1996 | Lugscheider, Erich May, J. Wulfhorst, B. Gries, T. Bärwulf, Stephan Bosserhoff, B. |
[Journal Article] Simulation von Strahlverschleiß In: Metall, 50 (11), 713-722, 1996 | Petersheim, J. Elsing, Rainer |
[Journal Article] Effect of single impact damage on strength of alumina and zirconia-toughened alumina In: Journal of materials science / Letters, 15, 1925-1926, 1996 | Lugscheider, Erich Huang, Xingija Tu, Mingjing |
[Journal Article] Das Reib- und Verschleißverhalten von ungeschmierten Ti-Al-C-N-PVD-Schichten In: Tribologie und Schmierungstechnik, 43 (2), 1996 | Lugscheider, Erich Löffler, Frank Wolff, C. |
[Journal Article] Kriterien für die Auswahl von Beschichtungsverfahren In: VDI-Z integrierte Produktion, 138 (1/2), 36-41, 1996 | Nyland, A. Kron, P. B. Ellermeier, J. Schierling, M. |
[Contribution to a conference proceedings, Journal Article] Deposition of arc TiAlN coatings with pulsed bias In: Surface & coatings technology, 76-77 (Part 2), 700-705, 1995 [DOI: 10.1016/02578-9729(68)00090-] | Lugscheider, E. Knotek, O. Loffler, F. Barimani, C. Guerreiro, S. Zimmermann, H. |
[Journal Article] Einsatz von Zwischenschichten zum Abbau von Spannungen in aktivgelöteten Siliciumnitrid-Stahl-Verbindungen In: Schweissen und Schneiden, 47 (2), 97-107, 1995 | Lugscheider, Erich Tillmann, W. Maier, H. R. Magin, Michael |
[Journal Article] Einsatz von PVD-Beschichtungen zur Minimierung von Kühlschmierstoffen bei der Zerspanung In: VDI-Z integrierte Produktion / Special, 1995, 1995 | Lugscheider, Erich Löffler, Frank Barimani, Cyrus Zimmermann, H. |
[Journal Article] Eigenschaften hart- und hochtemperaturgelöteter Titanverbindungen In: Schweissen und Schneiden, 47, 197-205, 1995 | Lugscheider, Erich Broich, U. Steffens, H.-D. Ashoff, D. |
[Journal Article] Design of wear resistant NiCr-TiC plasma sprayed coatings based on modifications in the carbide and the binder phase In: Wear, 185, 1995 | Economou, S. de Bonte, Marc Celis, Jean-Pierre Smith, R. W. Lugscheider, Erich |
[Journal Article] Wirtschaftlichkeitsanalyse neuer Beschichtungstechnologien In: VDI-Z integrierte Produktion, 137 (7//8), 42-46, 1995 | Lugscheider, Erich Gries, Thomas Wulfhorst, Burkhard May, Johannes Bosserhoff, Bert Hans |
[Journal Article] PVD-Beschichtungen contra Kühlschmierstoff-Verbrauch In: VDI-Z integrierte Produktion / Special, 1995 (4), 38-42, 1995 | Lugscheider, Erich Löffler, Frank Barimani, Cyrus Zimmermann, H. |
[Journal Article] Plasmaspritzen von Titanhartstoffen : Neue Möglichkeiten zum Verschleißschutz In: Schweissen und Schneiden, 47, 822-831, 1995 | Lugscheider, Erich Jungklaus, H. Wielage, B. Henker, A. |
[Journal Article] Heat resistant active brazing of silicon-nitride : P. 1: Mechanical evaluation of braze joints In: Welding journal, 74, 1995 | Lugscheider, Erich Tillmann, W. Schlimbach, K. Manter, C. Indacochea, J. E. |
[Journal Article] Thick thermal barrier coatings for Diesel engines In: Surface engineering, 11 (4), 1995 | Lugscheider, Erich Kvernes, I. |
[Journal Article] Thermal sprayed aluminium-silicon alloy coatings In: Materials and manufacturing processes, 10, 837-841, 1995 | Lugscheider, Erich Jokiel, P. Feldhege, M. |
[Journal Article] Tribological behaviour of TiC/TaC-reinforced cermet plasma sprayed coatings tested against sapphire In: Wear, 185 (1/2), 93-110, 1995 [DOI: 10.1016/0043-1648(95)06597-0] | Economou, S. de Bonte, Marc Celis, Jean-Pierre Roos, J. R. Smith, R. W. Lugscheider, Erich Valencic, A. |
[Journal Article] Arc-evaporation of multicomponent MCrAlY cathodes In: Surface & coatings technology, 74/75, 118-122, 1995 | Lugscheider, Erich Knotek, Otto Löffler, F. Beele, W. Barimani, Cyrus |
[Journal Article] Deposition of arc-TiAIN coatings with pulsed bias In: Surface & coatings technology, 76/77, 700-705, 1995 | Lugscheider, Erich Knotek, Otto Löffler, Frank Barimani, Cyrus Guerreiro, S. Zimmermann, H. |
[Journal Article] Steigerung der Warmfestigkeit der Bindephase von Cermets In: Metall, 49, 326-336, 1995 | Grewe, H. Kolaska, H. |
[Journal Article] Entwicklung von hochtemperaturbeständigen Aktivlötverbindungen aus Nichtoxidkeramik In: Metall, 48 (1), 27-33, 1994 | Lugscheider, Erich Tillmann, Walter Weise, W. |
[Contribution to a conference proceedings, Journal Article] The wear behaviour of heat-treated PVD coatings In: Surface & coatings technology, 68, 199-202, 1994 [DOI: 10.1016/0257-8972(94)90160-0] | Knotek, O. Löffler, F. Wolff, C. Wolkers, L. |
[Contribution to a conference proceedings, Journal Article] Behaviour of CVD and PVD coatings under impact load In: Surface & coatings technology, 68/69, 253-258, 1994 [DOI: 10.1016/0257-8972(94)90170-8] | Knotek, O. Lugscheider, E. Löffler, F. Schrey, A. Bosserhoff, B. |
[Journal Article] Plasma spraying of high-nitrogen-bearing steels for wear-resistant coatings and structural applications In: Journal of materials engineering and performance, 3 (4), 476-483, 1994 [DOI: 10.1007/BF02645313] | Khatri, S. Smith, R. Jokiel, P. Lugscheider, E. Bohley, M. |
[Journal Article] TiO2 - PVD. Sputtertemperatur und Haftfestigkeit In: Metalloberfläche : mo, 48, 40-45, 1994 | Pyun, S.-I. Yoon, Y.-G. Hyun, S.-M. Lugscheider, E. Mathesius, R. |
[Journal Article] Verbesserung der Eigenschaften von Hartlegierungen durch auftraggeschweißte carbidische Verbundpulver In: Schweissen und Schneiden, 46, 109-114, 1994 | Lugscheider, E. Ait-Mekideche, Azedine Melzer, A. |
[Journal Article] Phase-relations in the c-cr-fe system in the vicinity of the (liquid+bcc+m23c6+m7c3) invariant equilibrium - experimental determinations and thermodynamic modeling In: Zeitschrift für Metallkunde, 85 (5), 359-364, 1994 | Kowalski, M. Spencer, P. J. Granat, K. Drzeniek, H. Lugscheider, E. |
[Journal Article] Subsequent sealing of thermally sprayed coatings to increase corrosion resistance In: Surface engineering, 10, 46-51, 1994 | Lugscheider, E. Jokiel, P. Messerschmidt, V. Beckschulte, G. |
[Journal Article] Technologische Eigenschaften von Breitspaltlötverbindungen an Rohren In: Schweissen und Schneiden, 46, 274-276, 1994 | Lugscheider, E. Schmoor, H. |
[Journal Article] Einsetzbarkeit gelöteter Chrom-Nickel-Stähle in Wässern In: Der Praktiker, 46, 228-230, 1994 | Brandl, W. Steffens, H.-D. Rukzinski, D. Podleschny, R. Lugscheider, E. Minarski, P. |
[Journal Article] Neuartige Schweißzusatzwerkstoffe auf Fe-W-Ti-C-Basis gegen mineralischen Abrasivverschleiß In: Braunkohle, Tagebautechnik - Neue Bergbautechnik, 45, 24-28, 1994 | Lugscheider, Erich Reymann, H. |
[Journal Article] Kupferbasis-Reaktionslote. Ein Lösungsweg zum Löten poröser Sinterstähle In: Schweissen und Schneiden, 46, 425-429, 1994 | Lugscheider, E. Tillmann, W. Feng, M. E. Z. |
[Journal Article] Zur Ausbildung von Reaktionsschichten bei aktivgelöteten nichtoxidischen Ingenieurkeramiken. T. 1: Grundlagen und Wechselwirkung zwischen Aktivmetallen und Siliciumnitrid In: VTE : Aufbau- und Verbindungstechnik in der Elektronik, 1994, 156-162, 1994 | Tillmann, W. Lugscheider, E. Gale, W. F. |
[Journal Article] Zur Ausbildung von Reaktionsschichten bei aktivgelöteten nichtoxidischen Ingenieurkeramiken. T. 2: Wechselwirkung zwischen Aktivmetallen und Siliciumcarbid sowie Aluminiumnitrid In: VTE : Aufbau- und Verbindungstechnik in der Elektronik, 1994, 210-212, 1994 | Tillmann, W. Lugscheider, E. Gale, W. F. |
[Journal Article] Möglichkeiten des stoffschlüssigen Fügens metallischer Verbundwerkstoffe. Eine Übersicht In: Schweissen und Schneiden, 46, 543-549, 1994 | Tillmann, W. Lugscheider, E. |
[Journal Article] Cytotoxicity investigations of plasma sprayed calcium phosphate coatings In: Journal of materials science / Materials in medicine, 5, 371-375, 1994 [DOI: 10.1007/BF00058966] | Lugscheider, E. Knepper, M. Heimberg, B. Dekker, A. Kirkpatrick, C. J. |
[Journal Article] Pulvermetallurgie im Wettbewerb In: Met, 48, 899, 1994 | Lugscheider, E. Deiser, C. |
[Journal Article] Hochtemperatureigenschaften von MCrAlY(Ti,Hf) beschichtetem Ventilstahl X 45 CrSi 9 3 bei 600 und 700°C In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 24 (11), 397-403, 1993 [DOI: 10.1002/mawe.19930241110] | Lugscheider, Erich Müller, U. Holdinghausen, A. |
[Contribution to a conference proceedings, Journal Article] Performance behaviour of physical-vapour-deposition-coated cermets in interrupted-cut machining In: Surface & coatings technology, 62 (1/3), 669-673, 1993 [DOI: 10.1016/0257-8972(93)90316-G] | Knotek, O. Löffler, F. Krämer, G. |
[Journal Article] Interessante Anwendungen für das Hochtemperaturlöten In: Jahrbuch Schweißtechnik, 1994, 173-178, 1993 | Lugscheider, E. Tillmann, W. Schmoor, H. |
[Journal Article] Plasmaspritzen - Verfahren, Anwendungen, Entwicklungen In: Metall, 47, 230-236, 1993 | Lugscheider, E. Jokiel, P. |
[Journal Article] Werkstoff- und Prozeßentwicklung in der Beschichtungstechnik In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 5 (3), 42-45, 1993 | Lugscheider, E. Westermann, U. |
[Journal Article] Evaluation of d.c.-plasma jet chemical vapour deposition for diamond coatings on tungsten carbide based cutting plates In: Diamond and related materials, 2 (12), 1464-1466, 1993 [DOI: 10.1016/0925-9635(93)90013-R] | Lugscheider, E. Müller, U. |
[Journal Article] Zuverlässiges belastbares Fügeverfahren für Motorenbau und Energietechnik In: Handelsblatt : Deutschlands Wirtschafts- und Finanzzeitung, 63 (31.3.1993), 31, 1993 | Lugscheider, E. Tillmann, W. Weise, W. |
[Journal Article] Methods for brazing ceramic and metal-ceramic joints In: Materials and manufacturing processes, 8, 219-238, 1993 | Lugscheider, E. Tillmann, W. |
[Journal Article] Braze coat process combines with induction heating for deposition of wear-resistant materials In: Welding journal, 72 (5), 55-59, 1993 | Lugscheider, E. Gundlfinger, K. Schmoor, H. |
[Journal Article] Zukunftsweisende Tendenzen im Thermischen Spritzen In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 5 (5/6), 70-72, 1993 | Lugscheider, E. Jokiel, P. |
[Journal Article] Titandisilizid - ein korrosionsbeständiger Hochtemperatur-Werkstoff mit metallischen Eigenschaften In: Metall, 47, 741-745, 1993 | Westermann, U. Lugscheider, E. Wonka, J. |
[Journal Article] Verarbeitung Cr3C2-verstärkter Nickelhartlegierungen durch das autogene Flammspritzen In: Schweissen und Schneiden, 45, 494-498, 1993 | Lugscheider, E. Jokiel, P. Reimann, H. Heinrich, P. |
[Journal Article] Applying Cr3C2-reinforced nickel-based hard alloys by oxyacetylene flame spraying In: Welding and cutting, 1993 (9), E163- E166, 1993 | Lugscheider, E. Jokiel, P. Reimann, H. Heinrich, P. |
[Journal Article] Verarbeitung wolframcarbidverstärkter Nickelhartlegierungen durch Flammspritzen In: Schweissen und Schneiden, 45, 601-604, 1993 | Lugscheider, E. Jokiel, P. Karduck, P. Reimann, H. Heinrich, P. |
[Contribution to a conference proceedings, Journal Article] Arc deposition of Ti-C and Ti-C-N using acetylene as a reactive gas In: Vacuum, 43 (5/7), 645-648, 1992 [DOI: 10.1016/0042-207X(92)90098-H] | Knotek, Otto Löffler, Frank Krämer, G. |
[Contribution to a conference proceedings, Journal Article] Reproducible arc-PVD process management under various reactive gases In: Vacuum, 43 (5/7), 567-571, 1992 [DOI: 10.1016/0042-207X(92)90079-C] | Knotek, Otto Löffler, Frank Krämer, G. Stössel, C. |
[Contribution to a conference proceedings, Journal Article] Multicomponent and multilayer physically vapor-deposited coatings for cutting tools In: Surface & coatings technology, 54 (1/3), 241-248, 1992 [DOI: 10.1016/0257-8972(92)90169-B] | Knotek, Otto Löffler, Frank Kramer, G. |
[Journal Article] Thermisches Spritzen In: Keramische Zeitschrift, 44 (Beil.), 1-4, 1992 | Eschnauer, H. Lugscheider, E. Müller, U. Weber, T. |
[Journal Article] Entwicklung hochvakuumdichter Oxidkeramik-Metall-Lötverbindungen In: Schweissen und Schneiden, 44, 92-96, 1992 | Lugscheider, E. Boretius, M. |
[Journal Article] Surface engineering of Diesel engine parts - new technological achievements in powders and coating microstructures In: Powder metallurgy international : PMI, 24, 7-13, 1992 | Kvernes, I. Lugscheider, E. |
[Journal Article] Zusatzwerkstoffe zum Metall-Inertgasauftragschweißen In: Schweissen und Schneiden, 44, 138-143, 1992 | Lugscheider, E. Deppe, E. Ambroziak, Andrej Melzer, A. |
[Journal Article] Weld filler materials for metal-arc inert gas surface welding In: Welding and cutting, 1992 (3), E 50-E 53, 1992 | Lugscheider, E. Deppe, E. Ambroziak, Andrej Melzer, A. |
[Journal Article] Beschichtungen durch Vakuumplasmaspritzen In: Technica : die Fachzeitschrift für die Maschinen-, Elektro- und Metallindustrie, 41 (9), 19-22, 1992 | Lugscheider, E. Born, K. |
[Journal Article] Modelling of temperature gradients and stress-strain distributions during the plasma spraying process In: Powder metallurgy international : PMI, 24, 240-245, 1992 | Borgerding, B. Sölter, H.-J. Lugscheider, E. Simhan, K. |
[Journal Article] Kristalline Diamantschichten auf Schneidwerkzeugen In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 4 (7/8), 42-44, 1992 | Lugscheider, E. Müller, U. |
[Journal Article] High-speed temperature measurement for on-line process control and quality assurance during plasma-spraying In: Powder metallurgy international : PMI, 24, 169-175, 1992 | Sölter, H.-J. Müller, U. Lugscheider, E. |
[Journal Article] Optimization of spraying process and laser treatment of CoNiCrA1Y In: Journal of thermal spray technology : JTST, 1, 239-248, 1992 | Lugscheider, E. Hofmann, D. Nicoll, A. R. |
[Journal Article] Hochvakuumdichte Keramik-Metall-Lötverbindungen In: Metall, 46, 802-805, 1992 | Lugscheider, E. Boretius, M. |
[Journal Article] Comparison of properties of coatings produced by laser cladding and conventional methods In: Journal of materials science & technology : JMST, 8, 657-665, 1992 | Oberländer, B. C. Lugscheider, E. |
[Journal Article] Fügen von Keramik bei hohen Betriebstemperaturen In: Werkstoff und Innovation, 5 (5/6), 44-48, 1992 | Lugscheider, E. Tillmann, W. |
[Journal Article] Production of spherical powders - the first step for optimized thermal-sprayed apatite coatings In: Journal of thermal spray technology : JTST, 1, 215-221, 1992 | Lugscheider, E. Knepper, M. Gross, K. A. |
[Journal Article] Underwater plasma processing of stabilized zirconia for thermal barrier coatings In: Journal of thermal spray technology : JTST, 1, 49-55, 1992 | Lugscheider, E. Rass, I. |
[Journal Article] Metallographische Präparation plasmagespritzter Borcarbid-Schichten In: Praktische Metallographie = Practical metallography, 23, 501-512, 1992 | Lugscheider, E. Koch, D. Limbach, R. |
[Journal Article] The development of high vacuum-tight oxide ceramic-metal brazed joints In: Welding and cutting, 1992 (2), E 37-E 40, 1992 | Lugscheider, E. Boretius, M. |
[Contribution to a book, Contribution to a conference proceedings, Journal Article] Properties of arc-evaporated crn and (cr, al)n coatings In: Surface & coatings technology, 45 (1/3), 53-58, 1991 [DOI: 10.1016/0257-8972(91)90205-B] | Knotek, Otto Löffler, Frank Scholl, H. J. |
[Journal Article] On the origin of compressive stress in PVD coatings : an explicative model In: Surface & coatings technology, 46 (3), 265-274, 1991 [DOI: 10.1016/0257-8972(91)90169-W] | Knotek, Otto Elsing, Rainer Krämer, G. Jungblut, F. |
[Contribution to a conference proceedings, Journal Article] Ti(c,n) coatings using the arc process In: Surface & coatings technology, 46 (1), 39-46, 1991 [DOI: 10.1016/0257-8972(91)90148-P] | Ertürk, E. Knotek, Otto Burgmer, W. Prengel, H.-G. Heuvel, H. J. Dederichs, H. G. Stossel, C. |
[Journal Article] Magnetron-sputtered superhard coatings within the system Ti-B-C-N In: Vacuum, 41 (7/9), 2184-2186, 1990 [DOI: 10.1016/0042-207X(90)94220-K] | Knotek, O. Jungblut, F. Breidenbach, R. |
[Journal Article] Untersuchungen zur Korrosionsbeständigkeit hochtemperaturgelöteter Werkstoffe in Trinkwasser In: Schweissen und Schneiden, 41, 590-595, 1989 | Lugscheider, E. Minarski, P. |
[Journal Article] Werkstoffkundliche Untersuchungen zum Löten verschiedener orthodontischer Drähte In: Journal of orofacial orthopedics, 50, 506-517, 1989 | Hannemann, M. Minarski, P. Lugscheider, E. Diedrich, P. |
[Journal Article] Entwicklung und Optimierung von Eisen-Chrom-Bor-Kohlenstoff-Legierungen für das Metallichtbogenschweißen von Hartauftragungen mit Fülldrahtelektroden In: Schweissen und Schneiden, 41, 661-666, 1989 | Drzeniek, H. Granat, K. Li, Z. Lugscheider, E. |
[Journal Article] Erosionsverhalten von Nickelbasisloten beim Hochtemperaturlöten In: Schweissen und Schneiden, 41, 342-345, 1989 | Lugscheider, E. Cosack, T. |
[Journal Article] Oberflächenvorbehandlung schwer benetzbarer metallischer Werkstoffe In: Schweissen und Schneiden, 41, 221-225, 1989 | Lugscheider, E. Minarski, P. |
[Journal Article] Unterwasserplasmaspritzen - eine neue Verfahrensvariante In: Schweissen und Schneiden, 41, 547-550, 1989 | Lugscheider, E. Bugsel, B. |
[Journal Article] Erosionsverhalten von Nickelbasisloten beim Hochtemperaturlöten In: Schweissen und Schneiden, 41, 342-345, 1989 | Lugscheider, E. Cosack, T. |
[Journal Article] Laserunterstützte Beschichtungstechnologie - Verwirklichung neuer Werkstoffzustände mit dem Hochleistungslaser In: Schweissen und Schneiden, 40 (9), 1988 | Lugscheider, E. |
[Journal Article] Fügen von Hochleistungskeramik untereinander und mit Metall In: Technische Mitteilungen : TM, 80 (4), 1987 | Lugscheider, Erich Krappitz, Harald Boretius, M. |
[Journal Article] Stand und Entwicklungstendenzen beim Plasmaspritzen In: Elektrowärme international : ewi, 45, B 190-B 195, 1987 | Lugscheider, Erich Weber, Thomas |
[Journal Article] Überwältigendes Anwendungspotential. Plasmaspritzen von Verschleiss- schutzschichten In: Industrie-Anzeiger, 109 (83), 1987 | Lugscheider, Erich |