Fachzeitschriftenartikel

 
Quelle Autor(en)
Bewertung thermisch gespritzter Oxidkeramiken für die Isolationsanwendungen in der Elektromobilität
In: Thermal spray bulletin, 15 (2), 90-96, 2022
Bobzin, Kirsten
Heinemann, Hendrik
Burbaum, Elisa
Kalorimetrische Analyse von ternären Fe-Ni-Si-Legierungen für neuartige Lötfolien auf Fe-Basis
In: Schweissen und Schneiden, 74 (6), 368-373, 2022
Bobzin, Kirsten
Heinemann, Hendrik
Hebing, Julian
Stryzhyboroda, O.
Vinke, Sophie
Adaptive (Cr,Al)N+Mo:Sg Coating for Highly‐Stressed Contacts under Dry Rolling‐Sliding Conditions
In: Tribology international, 174, 107761, 2022
[DOI: 10.1016/j.triboint.2022.107761]
Bobzin, Kirsten
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
Stahl, K.
Lohner, T.
Maier, E.
Yilmaz, M.
High-Velocity Arc Spraying of Fe-based Metallic Glasses with High Si Content
In: Journal of thermal spray technology : JTST, 2022
[DOI: 10.1007/s11666-022-01433-w]
Bobzin, Kirsten
Wietheger, Wolfgang
Burbaum, Elisa
Johann, Lukas Martin (Corresponding author)
From cathode to substrate : Plasma diagnostics on high power pulsed magnetron sputtering deposition of titanium nitride
In: Thin solid films, 755, 139331, 2022
[DOI: 10.1016/j.tsf.2022.139331]
Bobzin, Kirsten
Kalscheuer, Christian
Carlet, Marco
Schulze, Christoph Franz Robert (Corresponding author)
Influence of brazing process and gap size on the fatigue strength of shear and peel specimen
In: Welding in the world, 2022
[DOI: 10.1007/s40194-022-01304-6]
Jöckel, A. (Corresponding author)
Baumgartner, J.
Tillmann, W.
Bültena, J.
Bobzin, Kirsten
Heinemann, Hendrik
Hebing, Julian
Erck, Marvin
Development of a novel green coating process with laser
In: Scientific reports, 12 (1), 6314, 2022
[DOI: 10.1038/s41598-022-10351-4]
Zhong, Chongliang (Corresponding author)
Backes, Gerhard
Johann, Lukas Martin
Kittel, Jochen
Schopphoven, Thomas
Küppers, Wolfgang
Entwicklung dichter Si-Beschichtungen mittels Atmosphärischen Plasmaspritzens
In: Thermal spray bulletin, 15 (1), 34-40, 2022
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Wietheger, Wolfgang
Burbaum, Elisa (Corresponding author)
Low-Temperature Physical Vapor Deposition TiAlCrSiN Coated High-Speed Steel : Comparison Between Shot-Peened and Polished Substrate Condition
In: Advanced engineering materials, 2200099, 2022
[DOI: 10.1002/adem.202200099]
Bobzin, Kirsten
Kalscheuer, Christian
Carlet, Marco
Hoffmann, Dennis Christopher (Corresponding author)
Bergs, Thomas
Uhlmann, Lars
Hybrid reactive sputtering of transition metal aluminum oxynitrides
In: Thin solid films, 742, 139028, 2021
[DOI: 10.1016/j.tsf.2021.139028]
Bobzin, Kirsten
Kalscheuer, Christian
Carlet, Marco (Corresponding author)
Schulze, Christoph Franz Robert
Schneller und günstiger zum Ziel
In: Magazin für Oberflächentechnik : mo, 76 (1/2), 32-35, 2022
Bobzin, Kirsten
Kalscheuer, Christian
Carlet, Marco
Schulze, Christoph Franz Robert
Comparison of Ceramic Insulation Coatings via Impedance Spectroscopy
In: Journal of thermal spray technology : JTST, 31 (5), 1556-1567, 2022
[DOI: 10.1007/s11666-022-01395-z]
Bobzin, Kirsten
Wietheger, Wolfgang
Burbaum, Elisa (Corresponding author)
Hosenfeldt, Tim
Bagcivan, Nazlim
Öte, Mehmet
Müller, Björn
Kunde, Carsten
Elsner, Anna-Lena
Triboaktive Beschichtungen : Neue Entwicklungen für fluidfrei geschmierte Stirnradverzahnungen
In: Vakuum in Forschung und Praxis, 34 (1), 18-23, 2022
[DOI: 10.1002/vipr.202200771]
Bobzin, Kirsten
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
Application and benchmark of SPH for modeling the impact in thermal spraying
In: Computational particle mechanics : CPM, 2022
[DOI: 10.1007/s40571-022-00459-9]
Jeske, Stefan Rhys (Corresponding author)
Bender, Jan Stephen
Bobzin, Kirsten
Heinemann, Hendrik
Jasutyn, Kevin
Simon, Marek Sebastian
Mokrov, Oleg
Sharma, Rahul
Reisgen, Uwe
Capturing the Influence of Jet Fluctuations on Particles in Plasma Spraying
In: Journal of thermal spray technology, 31 (1/2), 59-69, 2022
[DOI: 10.1007/s11666-021-01307-7]
Bobzin, Kirsten
Heinemann, Hendrik (Corresponding author)
O'Brien, Andreas
CrN/AlN nanolaminates: Architecture, residual stresses, and cracking behavior
In: Journal of vacuum science & technology / A, 40 (1), 013414, 2021
[DOI: 10.1116/6.0001462]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Maier, H. J.
Heidenblut, T.
Besserer, H.-B.
Kahra, C.
Janowitz, Julia (Corresponding author)
Impact Resistance and Properties of (Cr,Al,Si)N Coatings Deposited by Gas Flow Sputtering with Pulsed DC Supply
In: Advanced engineering materials, 24 (4), 2101021, 2021
[DOI: 10.1002/adem.202101021]
Bobzin, Kirsten
Kalscheuer, Christian
Hassanzadegan Aghdam, Parisa (Corresponding author)
Durability of nanolayer Ti-Al-O-N hard coatings under simulated polycarbonate melt processing conditions
In: Journal of physics / D, 55 (3), 035204, 2021
[DOI: 10.1088/1361-6463/ac2e31]
Brögelmann, Tobias
Bobzin, Kirsten
Grundmeier, G.
de los Arcos, T.
Kruppe, Nathan Christopher
Schwiderek, S.
Carlet, Marco (Corresponding author)
Crack Resistance of Diamond‐Like Carbon Coatings : Investigations with Nanoindentation
In: Vakuum in Forschung und Praxis, 33 (6), 36-42, 2021
[DOI: 10.1002/vipr.202100769]
Bobzin, Kirsten
Brögelmann, Tobias
Carlet, Marco (Corresponding author)
Kruppe, Nathan Christopher
Engels, Martin Gottfried
Arghavani, Mostafa
Self-lubricating CrAlVN coatings for turning of Ti6Al4V: oxidation and wear behavior
In: Materials science and engineering technology, 52 (12), 1394-1412, 2021
[DOI: 10.1002/mawe.202100042]
Bobzin, Kirsten
Brögelmann, Tobias
Stachowski, Nina Isabell Inge (Corresponding author)
Hintze, W.
Möller, C.
Ploog, P.
Tribological and corrosive influence of graphite in thermally sprayed Cr3C2/NiCr coatings
In: Thermal spray bulletin, 14 (2), 112-119, 2021
Bobzin, Kirsten
Wietheger, Wolfgang
Burbaum, Elisa
Schulz, Marvin
Structural analyses of a CrN/AlN nanolaminate hard coating after nanoscratch test
In: Thin solid films, 738, 138964, 2021
[DOI: 10.1016/j.tsf.2021.138964]
Bobzin, Kirsten
Brögelmann, Tobias
Mayer, Joachim
Iskandar, Mohamad Riza
Kruppe, Nathan Christopher
Naderi, Mona (Corresponding author)
Influence of the Titanium Inoculation on the Melting Behavior and Microstructure of Ni 620/X38CrMoV5-1 Brazing Joints
In: Advanced engineering materials, 23 (12), 2100497, 2021
[DOI: 10.1002/adem.202100497]
Bobzin, Kirsten
Wietheger, Wolfgang
Hebing, Julian (Corresponding author)
Understanding the Tribological Behavior of Graded (Cr,Al)N + Mo:S in Fluid-Free Friction Regime
In: Tribology letters, 69 (4), 162, 2021
[DOI: 10.1007/s11249-021-01536-5]
Bobzin, Kirsten
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
Thermal stability of CrAlN/AlCrN nanolaminate coating deposited by hybrid dcMS/HPPMS after heat treatment with continuous-wave laser
In: Applied surface science, 569, 151024, 2021
[DOI: 10.1016/j.apsusc.2021.151024]
Bobzin, Kirsten
Brögelmann, Tobias
Mayer, Joachim
Aretz, Anke
Iskandar, Mohamad Riza
Kruppe, Nathan Christopher
Naderi, Mona (Corresponding author)
Influence of Aluminum Content on the Impact Fatigue of HPPMS CrAlN Coatings on Tool Steel
In: Physical mesomechanics, 24 (5), 625-632, 2021
[DOI: 10.1134/S1029959921050143]
Bobzin, Kirsten
Kalscheuer, Christian
Carlet, Marco
Tayyab, Muhammad (Corresponding author)
Thermisch gespritzte Beschichtungen für den Armaturenbau
In: Materials science and engineering technology, 52 (9), 997-1011, 2021
[DOI: 10.1002/mawe.202100032]
Bobzin, Kirsten
Wietheger, Wolfgang
Heinemann, Hendrik
Schulz, Marvin (Corresponding author)
Oechsner, Matthias
Engler, T.
Scheerer, H.
Joung, Y.
Influence of a short reverse positive HPPMS pulse on the deposition of CrAlN
In: Surface and coatings technology, 423, 127625, 2021
[DOI: 10.1016/j.surfcoat.2021.127625]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Eichenhofer, G.
Schulze, Christoph Franz Robert (Corresponding author)
Influence of residual stresses in hard tool coatings on the cutting performance
In: Journal of manufacturing processes, 69, 340-350, 2021
[DOI: 10.1016/j.jmapro.2021.08.011]
Bobzin, Kirsten
Brögelmann, Tobias
Maier, Hans Jürgen
Heidenblut, Torsten
Kahra, Christoph
Carlet, Marco (Corresponding author)
HPPMS tool coatings: Chip formation and friction
In: Vakuum in Forschung und Praxis, 33 (4), 26-33, 2021
[DOI: 10.1002/vipr.202100765]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Carlet, Marco (Corresponding author)
Hoffmann, Dennis Christopher
Breidenstein, Bernd
Krödel-Worbes, Alexander
Beblein, Sascha
Smart PVD hard coatings with temperature sensor function
In: Surface and coatings technology, 423, 127631, 2021
[DOI: 10.1016/j.surfcoat.2021.127631]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Janowitz, Julia (Corresponding author)
Particle tailored effective particle-gas interaction coefficients during plasma spraying
In: Thermal spray bulletin, 14 (1), 40-45, 2021
Bobzin, Kirsten
Wietheger, Wolfgang
Heinemann, Hendrik
Alkhasli, Ilkin
Prediction of Particle Properties in Plasma Spraying based on Machine Learning
In: Journal of thermal spray technology, 30 (7), 1751-1764, 2021
[DOI: 10.1007/s11666-021-01239-2]
Bobzin, Kirsten
Wietheger, Wolfgang
Heinemann, Hendrik
Dokhanchi, Seyed Ruhollah (Corresponding author)
Rom, Christian Michael
Visconti, Giuseppe
Pulse synchronized substrate bias for the High Power Pulsed Magnetron Sputtering deposition of CrAlN
In: Thin solid films, 732, 138792, 2021
[DOI: 10.1016/j.tsf.2021.138792]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Engels, Martin Gottfried
Schulze, Christoph Franz Robert (Corresponding author)
Design of a TiAlON multilayer coating : Oxidation stability and deformation behavior
In: Surface and coatings technology, 421, 127417, 2021
[DOI: 10.1016/j.surfcoat.2021.127417]
Bobzin, Kirsten
Kalscheuer, Christian
Grundmeier, G.
de los Arcos, T.
Schwiderek, S.
Carlet, Marco (Corresponding author)
Self-lubricating triboactive (Cr,Al)N+Mo:S coatings for fluid-free applications
In: Journal of materials science, 56 (27), 15040-15060, 2021
[DOI: 10.1007/s10853-021-06255-9]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
Use of displacement and force sensors to improve process control during induction brazing of carbide-steel joints
In: Welding and cutting, 20 (1), 50-56, 2021
Bobzin, Kirsten
Wietheger, Wolfgang
Hebing, Julian
Investigation on the incorporation of oxygen and thermal stability of HPPMS TiAlCrSiON nanolayer coatings
In: Surface and coatings technology, 418, 127231, 2021
[DOI: 10.1016/j.surfcoat.2021.127231]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Carlet, Marco (Corresponding author)
Development of Thermal Spray Processes for Depositing Coatings on Thermoplastics
In: Journal of thermal spray technology : JTST, 30 (1/2), 157-167, 2021
[DOI: 10.1007/s11666-020-01147-x]
Bobzin, Kirsten
Wietheger, Wolfgang
Knoch, Martin Andreas (Corresponding author)
DLC coated spur gears : Part II : coating properties and potential for industrial use
In: Industrial Lubrication and Tribology, 73 (4), 621-634, 2021
[DOI: 10.1108/ILT-07-2020-0256]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Thiex, Matthias
Schwarz, Andreas
Ebner, Martin
Lohner, Thomas
Stahl, Karsten
STEM investigations of the influence of copper on alumina scale detachment during in-situ wetting experiments of Al-7Si-0.3Mg alloy with 95Sn-5Cu filler metal
In: International journal of materials research : IJMR, 112 (5), 415-421, 2021
[DOI: 10.1515/ijmr-2020-8028]
Vayyala, Ashok
Aretz, Anke
Bobzin, Kirsten
Wietheger, Wolfgang
Hebing, Julian (Corresponding author)
Iskandar, Mohamad Riza
Mayer, Joachim
Schmidt, Alexander
High-Speed Video Analysis of the Process Stability in Plasma Spraying
In: Journal of thermal spray technology : JTST, 30 (4), 987-1000, 2021
[DOI: 10.1007/s11666-021-01159-1]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Alkhasli, Ilkin
Heinemann, Hendrik (Corresponding author)
DLC-coated spur gears : part I: friction reduction
In: Industrial lubrication & tribology, 73 (3), 457-469, 2021
[DOI: 10.1108/ILT-07-2020-0257]
Schwarz, Andreas
Ebner, Martin
Lohner, Thomas
Stahl, Karsten
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Thiex, Matthias
Thermally sprayed sensor coatings for spatially resolved temperature detection
In: Journal of materials processing technology, 291, 117043, 2021
[DOI: 10.1016/j.jmatprotec.2021.117043]
Bobzin, Kirsten
Wietheger, Wolfgang
Knoch, Martin Andreas
Heinemann, Hendrik
Schacht, Andreas (Corresponding author)
Gillner, Arnold
Hummel, Marc Daniel
Softening Behavior of Cold-Sprayed Aluminum-Based Coatings AA1200 and AA7075 During Annealing
In: Journal of thermal spray technology : JTST, 30 (1/2), 358-370, 2020
[DOI: 10.1007/s11666-020-01121-7]
Bobzin, Kirsten
Wietheger, Wolfgang
Hebing, Julian
Gerdt, Leonid (Corresponding author)
Enhancement of the insulation properties of thermal sprayed ceramic bearing coatings
In: Bearing world journal, 5, 35-46, 2020
Bobzin, Kirsten
Wietheger, Wolfgang
Knoch, Martin Andreas
Burbaum, Elisa
Hosenfeldt, Tim
Bagcivan, Nazlim
Öte, Mehmet
Heckl, Astrid
Müller, Björn
Kunde, Carsten
Elsner, Anna-Lena
HPPMS TiAlCrSiN - Influence of substrate bias and pulse frequency on cutting performance
In: Surface and coatings technology, 397, 126056, 2020
[DOI: 10.1016/j.surfcoat.2020.126056]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Carlet, Marco (Corresponding author)
Steigerung der Leistungsfähigkeit technischer Kunststoffe durch DLC-Beschichtungen
In: Tribologie und Schmierungstechnik, 67, 15-24, 2020
[DOI: 10.30419/TuS-2020-0014]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Thiex, Matthias
PVD Coated Tools and Surface-Structured Workpieces in Dry Cold Forming of Steel
In: Defect and diffusion forum, 404, 19-27, 2020
[DOI: 10.4028/www.scientific.net/DDF.404.19]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Bergs, Thomas
Mattfeld, Patrick-Marcel
Trauth, Daniel
Hild, Rafael
Hoffmann, Dennis Christopher (Corresponding author)
Temperature Measurement on Tool Surfaces by Wear Resistant PVD Sensor Coatings
In: Defect and diffusion forum, 404, 138-145, 2020
[DOI: 10.4028/www.scientific.net/DDF.404.138]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Janowitz, Julia (Corresponding author)
Self-Lubricating PVD Hard Coatings Through Tribological Activation
In: Defect and diffusion forum, 404, 109-116, 2020
[DOI: 10.4028/www.scientific.net/DDF.404.109]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Stachowski, Nina Isabell Inge (Corresponding author)
Combination of a laser deposition welded corrosion protection coating and a thermally sprayed wear protection coating
In: Thermal spray bulletin, 13 (2), 114-121, 2020
Bobzin, Kirsten
Wietheger, Wolfgang
Knoch, Martin Andreas
Sommer, Jan
Schleifenbaum, Johannes Henrich
Nutzung von Weg- und Kraftsensoren zur Verbesserung der Prozesskontrolle beim Induktionslöten von Hartmetall-Stahl-Fügeverbunden
In: Schweissen und Schneiden, 72 (11), 694-701, 2020
Bobzin, Kirsten
Wietheger, Wolfgang
Hebing, Julian
Effects of (Cr,Al)N and (Cr,Al,Mo)N coatings on friction under minimum quantity lubrication
In: Surface and coatings technology, 402, 126154 -, 2020
[DOI: 10.1016/j.surfcoat.2020.126154]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian (Corresponding author)
Stahl, K.
Lohner, T.
Yilmaz, M.
Brazed coatings for steam turbine blades : impact of the tape architecture and composition on mechanical properties
In: International journal of materials research : IJMR, 111 (11), 916-922, 2020
[DOI: 10.3139/146.111956]
Bobzin, Kirsten
Wietheger, Wolfgang
Hebing, Julian
Gerdt, Leonid (Corresponding author)
Uddin, M.
Determination of local deposition efficiency based on in-flight particle diagnostics in plasma spraying
In: Surface and coatings technology, 399, 126118, 2020
[DOI: 10.1016/j.surfcoat.2020.126118]
Bobzin, Kirsten
Wietheger, Wolfgang
Heinemann, Hendrik
Dokhanchi, Seyed Ruhollah (Corresponding author)
Heating behaviour of plasma sprayed TiOx/Cr2O3 coatings for injection moulding
In: Surface and coatings technology, 399, 126199, 2020
[DOI: 10.1016/j.surfcoat.2020.126199]
Bobzin, Kirsten
Wietheger, Wolfgang
Knoch, Martin Andreas
Schacht, Andreas (Corresponding author)
Excellence cluster "Internet of Production" (IoP) of the RWTH Aachen - The digital world and production of the future
In: Thermal spray bulletin, 13 (1), 12-14, 2020
Brockmann, Matthias
Wassong, Anja
Bobzin, Kirsten
Wietheger, Wolfgang
Heinemann, Hendrik
Thermally sprayed coatings for highly stressed sliding bearings
In: Wear : an international journal on the science and technology of friction, lubrication and wear, 458/459, 203415, 2020
[DOI: 10.1016/j.wear.2020.203415]
Bobzin, Kirsten
Wietheger, Wolfgang (Corresponding author)
Jacobs, Georg
Bosse, Dennis
Schröder, Tim
Rolink, Amadeus Franziskus
Formation mechanisms of zinc, molybdenum, sulfur and phosphorus containing reaction layers on a diamond-like carbon (DLC) coating
In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 51 (7), 1009-1030, 2020
[DOI: 10.1002/mawe.201900178]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
Dry forming of low alloy steel materials by full forward impact extrusion with self-lubricating tool coatings and structured workpieces
In: Dry metal forming open access journal : DMFOAJ, 6, 69-98, 2020
[DOI: 10.26092/elib/167]
Bobzin, Kirsten
Klocke, Fritz
Bergs, Thomas
Brögelmann, Tobias
Feuerhack, Andreas
Kruppe, Nathan Christopher
Hild, Rafael (Corresponding author)
Hoffmann, Dennis Christopher (Corresponding author)
Further development of iron-based, titanium carbide reinforced thermal spray coatings for wear protection under corrosive loads
In: Thermal spray bulletin, 13 (1), 44-51, 2020
Bobzin, Kirsten
Wietheger, Wolfgang
Königstein, Tim Denis Stefan
Zhao, Lidong
malik, katarzyna maria
Key influencing factors for the thermal shock resistance of La2Zr2O7-based multilayer TBCs
In: Surface and coatings technology, 396, 125951, 2020
[DOI: 10.1016/j.surfcoat.2020.125951]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Wietheger, Wolfgang
Königstein, Tim Denis Stefan
A Visit to the Surface Engineering Institte (IOT) of RWTH Aachen University
In: Thermal spray bulletin, 43 (1), 22-23, 2020
Bobzin, Kirsten
Wietheger, Wolfgang (Corresponding author)
Comparison of Residual Stress Measurements Conducted by X-ray Stress Analysis and Incremental Hole Drilling Method
In: Journal of thermal spray technology : JTST, 29 (6), 1218-1228, 2020
[DOI: 10.1007/s11666-020-01056-z]
Bobzin, Kirsten
Wietheger, Wolfgang
Knoch, Martin Andreas
Schacht, Andreas (Corresponding author)
Reisgen, Uwe
Sharma, Rahul
Oster, Lukas Emmanuel
Approaches and possibilities for reducing residual stresses in induction brazed cemented carbide/steel joints
In: Welding in the world, 64 (9), 1579-1587, 2020
[DOI: 10.1007/s40194-020-00928-w]
Bobzin, Kirsten
Öte, Mehmet
Hebing, Julian (Corresponding author)
Correlation of thermal characteristics and microstructure of multilayer electron beam physical vapor deposition thermal barrier coatings
In: Thin solid films, 707, 138081, 2020
[DOI: 10.1016/j.tsf.2020.138081]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Yildirim, Baycan
Welters, Martin (Corresponding author)
Influence of direct electric current on wetting behavior during brazing
In: Frontiers of mechanical engineering, 15 (3), 496-503, 2020
[DOI: 10.1007/s11465-019-0582-6]
Bobzin, Kirsten
Wietheger, Wolfgang
Hebing, Julian
Zhao, Lidong
Schmidt, Alexander (Corresponding author)
Iskandar, Mohamad Riza
Mayer, Joachim
Macroscopic Modeling of an Agglomerated and Sintered Particle in Air Plasma Spraying
In: Journal of thermal spray technology, 29, 13-24, 2019
[DOI: 10.1007/s11666-019-00964-z]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Alkhasli, Ilkin (Corresponding author)
Estimation of Particle Mass Flow Rate in Free Jet Using In-Flight Particle Diagnostics in Plasma Spraying
In: Journal of thermal spray technology : JTST, 29 (5), pages921-931, 2020
[DOI: 10.1007/s11666-020-01027-4]
Bobzin, Kirsten
Wietheger, Wolfgang
Knoch, Martin Andreas
Dokhanchi, Seyed Ruhollah (Corresponding author)
ITSC 2020: Amazing Opportunities Await
In: Advanced materials & processes : AM&P, 178 (3), 36-36, 2020
Bobzin, Kirsten
Deposition of a nanocomposite (Ti, Al, Si)N coating with high thickness by high-speed physical vapor deposition
In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 51 (3), 297-312, 2020
[DOI: 10.1002/mawe.201900103]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Yildirim, Baycan
Liang, Tiancheng (Corresponding author)
Influence of the Injector Head Geometry on the Particle Injection in Plasma Spraying
In: Journal of thermal spray technology : JTST, 29 (4), 534-545, 2020
[DOI: 10.1007/s11666-020-01009-6]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Heinemann, Hendrik (Corresponding author)
Fatigue of brazed joints made of X5CrNi18-10 and Cu110 and derivation of reliable assessment approaches
In: Welding in the world, 64 (4), 707-719, 2020
[DOI: 10.1007/s40194-020-00850-1]
Baumgartner, J. (Corresponding author)
Tillmann, W.
Bobzin, Kirsten
Öte, Mehmet
Wiesner, Stefanie
Sievers, N.
Arc PVD (Cr,Al,Mo)N and (Cr,Al,Cu)N coatings for mobility applications
In: Surface and coatings technology, 384, 125046, 2019
[DOI: 10.1016/j.surfcoat.2019.125046]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian (Corresponding author)
Self‐Lubricating Physical Vapor Deposition Coatings for Dry Cold Massive Forming
In: Steel research international, 91 (5), 1900475, 2019
[DOI: 10.1002/srin.201900475]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Bergs, Thomas
Trauth, Daniel
Hild, Rafael
Mannens, Robby Norbert
Hoffmann, Dennis Christopher (Corresponding author)
Evalution of Two Repair Methods for Duplex-Coatings
In: Thermal spray bulletin, 12 (2), 98-104, 2019
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Prenger, Frank
Jantze, Raphael
Krömmer, Werner
Hochleistungsplasmen zur Entwicklung dünner Hartstoffschichten für Werkzeuge
In: Werkstoffe in der Fertigung (2), 18-19, 2019
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Carlet, Marco (Corresponding author)
Self-lubricating PVD Coatings in Interaction with Textured Workpiece Surfaces for Bulk Metal Forming
In: Dry metal forming open access journal, 5, 39-45, 2019
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Bergs, Thomas
Hild, Rafael
Feuerhack, Andreas
Hoffmann, Dennis Christopher (Corresponding author)
Structure, mechanical characteristics and thermal stability of high speed physical vapor deposition (Al,Cr)2O3 coatings
In: Thin solid films, 690, 137529, 2019
[DOI: 10.1016/j.tsf.2019.137529]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Welters, Martin (Corresponding author)
Wear behavior and thermal stability of HPPMS (Al,Ti,Cr,Si)ON, (Al,Ti,Cr,Si)N and (Ti,Al,Cr,Si)N coatings for cutting tools
In: Surface and coatings technology, 385, 125370, 2019
[DOI: 10.1016/j.surfcoat.2020.125370]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Carlet, Marco (Corresponding author)
Modellierung des Tribosystems beim trockenen Vollvorwärtsfließ-pressen mithilfe eines erweiterten Reibmodells
In: Dry metal forming open access journal, 5, 1-8, 2019
Bergs, Thomas
Hild, Rafael (Corresponding author)
Feuerhack, Andreas
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Hoffmann, Dennis Christopher
Effects of the Ion to Growth Flux Ratio on the Constitution and Mechanical Properties of Cr1-x-Alx-N Thin Films
In: ACS combinatorial science, 21 (12), 782-793, 2019
[DOI: 10.1021/acscombsci.9b00123]
Banko, Lars
Ries, Stefan
Grochla, Dario
Arghavani, Mostafa
Salomon, Steffen
Pfetzing-Micklich, Janine
Kostka, Aleksander
Rogalla, Detlef
Schulze, Julian
Awakowicz, Peter
Ludwig, Alfred (Corresponding author)
Nanocomposite (Ti,Al,Cr,Si)N HPPMS coatings for high performance cutting tools
In: Surface and coatings technology, 378, 124857, 2019
[DOI: 10.1016/j.surfcoat.2019.07.073]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Carlet, Marco (Corresponding author)
Investigation on the influence of oxygen on the deformation and cracking behavior of (Cr,Al)ON hard coatings using combinatorial static and dynamic loadings
In: Journal of vacuum science & technology / A : JVST, 37 (6), 061509, 2019
[DOI: 10.1116/1.5124615]
Brögelmann, Tobias
Bobzin, Kirsten
Kruppe, Nathan Christopher
Arghavani, Mostafa (Corresponding author)
Characterization and evaluation of emissions during thermal spraying under production-relevant conditions
In: Thermal spray bulletin, 12 (2), 78-87, 2019
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan
Wietheger, Wolfgang (Corresponding author)
Kraus, Thomas
Möller, Manfred
(Cr,Al)N and (Cr,Al,Mo)N hard coatings for tribological applications under minimum quantity lubrication
In: Tribology international, 140, 105817, 2019
[DOI: 10.1016/j.triboint.2019.06.010]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian (Corresponding author)
Stahl, K.
Lohner, T.
Yilmaz, M.
Post-annealing of (Ti,Al,Si)N coatings deposited by high speed physical vapor deposition (HS-PVD)
In: Surface and coatings technology, 375, 752-762, 2019
[DOI: 10.1016/j.surfcoat.2019.06.100]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Liang, Tiancheng (Corresponding author)
Understanding the deformation and cracking behavior of Cr-based coatings deposited by hybrid direct current and high power pulse magnetron sputtering : From nitrides to oxynitrides
In: Thin solid films, 688, 137354, 2019
[DOI: 10.1016/j.tsf.2019.06.004]
Brögelmann, Tobias
Bobzin, Kirsten
Kruppe, Nathan Christopher
Arghavani, Mostafa (Corresponding author)
Influence of Microstructures on Thermal Shock and Sintering Behavior of YSZ-Based Thermal Barrier Coatings
In: Surface technology, 48 (4), 28-33, 2019
[DOI: 10.16490/j.cnki.issn.1001-3660.2019.04.004]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Öte, Mehmet
Königstein, Tim Denis Stefan
Laserstrukturierte nitridische und oxinitridische Beschichtungen abgeschieden mittels Mittelfrequenz‐Magnetron‐Sputtering
In: International journal of material science, 50 (9), 1057-1069, 2019
[DOI: 10.1002/mawe.201800170]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Naderi, Mona (Corresponding author)
Incorporation of oxygen at column boundaries in (Cr,Al)ON hard coatings
In: Thin solid films, 685, 275-281, 2019
[DOI: 10.1016/j.tsf.2019.06.047]
Brögelmann, Tobias
Bobzin, Kirsten
Kruppe, Nathan Christopher
Carlet, Marco
Thermal Cyclic Oxidation Behavior of y-TiAl with in situ post-annealed Al-Si-Y Coating
In: Journal of vacuum science & technology: JVST, 37 (4), 041401, 2019
[DOI: 10.1116/1.5094835]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Liang, Tiancheng (Corresponding author)
(Cr,Al)ON Deposited by Hybrid dcMS/HPPMS: A study on Incorporation of Oxygen
In: Surface and coatings technology, 369, 238-243, 2019
[DOI: 10.1016/j.surfcoat.2019.04.066]
Brögelmann, Tobias
Bobzin, Kirsten
Kruppe, Nathan Christopher (Corresponding author)
Carlet, Marco
Potenziale thermisch gespritzter Gleitlager für hochbelastete Lagerstellen
In: Thermal spray bulletin, 12 (1), 31-37, 2019
Bobzin, Kirsten
Öte, Mehmet (Corresponding author)
Königstein, Tim Denis Stefan (Corresponding author)
Wietheger, Wolfgang (Corresponding author)
Bestimmung der Chromspezies beim Thermischen Spritzen
In: Thermal spray bulletin, 41 (1), 18-19, 2019
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan
Wietheger, Wolfgang
Kraus, Thomas
Möller, Manfred
PVD-Schutzschichten für Werkzeuge des Präzisionsblankpressens
In: Vakuum in Forschung und Praxis, 31 (2), 25-31, 2019
[DOI: 10.1002/vipr.201900711]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Stanek, Bonnie
Naderi, Mona (Corresponding author)
Influence of Oxides on the Performance of Cylinder Bore Coatings of Engine Blocks
In: Advanced composite materials, 21 (7), 1900006, 2019
[DOI: 10.1002/adem.201900006]
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan (Corresponding author)
Analysis of wear phenomena during forward extrusion under dry friction conditions
In: Wear : an international journal on the science and technology of friction, lubrication and wear, 426/427 (B), 1362-1370, 2019
[DOI: 10.1016/j.wear.2019.01.127]
Hild, Rafael (Corresponding author)
Bergs, Thomas
Mattfeld, Patrick-Marcel
Trauth, Daniel
Klocke, Fritz
Hoffmann, Dennis Christopher
Kruppe, Nathan Christopher
Brögelmann, Tobias
Bobzin, Kirsten
Formation of Tribochemical Reaction Layers on a Metal Modified Amorphous Carbon Coating a-C:H:Zr (ZrCg)
In: Tribology international, 135, 152-160, 2019
[DOI: 10.1016/j.triboint.2019.02.040]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
A highly porous thermal barrier coating based on Gd2O3-Yb2O3 co-doped YSZ
In: Surface and coatings technology, 366, 349-354, 2019
[DOI: 10.1016/j.surfcoat.2019.03.064]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Öte, Mehmet
Königstein, Tim Denis Stefan
Effect of Different Atomization Gases on the Properties of Cylinder Bore Coatings
In: Advanced engineering materials, 21 (2), 1800853, 2018
[DOI: 10.1002/adem.201800853]
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan (Corresponding author)
Development of a FeCrMnBC-based economical wear and corrosion resistant coating
In: Surface and coatings technology, 362, 12-20, 2019
[DOI: 10.1016/j.surfcoat.2019.01.074]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Öte, Mehmet
Königstein, Tim Denis Stefan
Wear behavior of HVOF-sprayed Al0.6TiCrFeCoNi high entropy alloy coatings at different temperatures
In: Surface and coatings technology, 358, 215-222, 2018
[DOI: 10.1016/j.surfcoat.2018.11.052]
Chen, Lijia
Bobzin, Kirsten
Zhou, Zheng (Corresponding author)
Zhao, Lidong
Öte, Mehmet
Königstein, Tim Denis Stefan
Tan, Zhen
He, Dingyong
Macroscopic particle modeling in air plasma spraying
In: Surface and coatings technology, 364, 449-456, 2018
[DOI: 10.1016/j.surfcoat.2018.07.056]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Alkhasli, Ilkin (Corresponding author)
New Material Concepts for Thermally Sprayed Hydrodynamic Bearings
In: Journal of thermal spray technology : JTST, 28 (1/2), 305-313, 2019
[DOI: 10.1007/s11666-018-0822-z]
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan
Wietheger, Wolfgang (Corresponding author)
Schröder, Tim
Jacobs, Georg
Bosse, Dennis
Influence of Powder Size on the Corrosion and Wear Behaviorof HVAF-Sprayed Fe-Based Coatings
In: Journal of thermal spray technology : JTST, 28 (1/2), 63-75, 2018
[DOI: 10.1007/s11666-018-0819-7]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Sommer, Jan (Corresponding author)
Influence of HPPMS on Hybrid dcMS/HPPMS (Cr,Al)N Processes
In: Surface and coatings technology, 358, 57-66, 2018
[DOI: 10.1016/j.surfcoat.2018.11.032]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher (Corresponding author)
Engels, Martin Gottfried
Designing the Corrosion Products of ZnAl15: A new Approach to Smart Corrosion Protection Coatings?
In: Corrosion science, 155, 217-229, 2017
[DOI: 10.1016/j.corsci.2017.12.015]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas (Corresponding author)
In situ Analyse beim Löten von Hartmetallen mittels Messungen des elektrischen Widerstandes
In: Materials testing, 60 (4), 349-354, 2018
[DOI: 10.3139/120.111165]
Tillmann, Wolfgang
Sievers, Norman (Corresponding author)
Schmidt, Alexander
Timmer, Christian
Neue Möglichkeiten für Fe-basis Beschichtungen durch HVAF-Spritzen
In: 11. Kolloquium Hochgeschwindigkeits-Flammspritzen/HVOF Spraying, 25. und 26. Oktober 2018, Erding : Tagungsunterlagen : conference proceedings / GTS Europe, Linde - The Linde Group, 19-31, 2018
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan
Zhao, Lidong
Sommer, Jan
Malik, Katarzyna (Corresponding author)
Dünne PVD-Hartstoffschichten zur Online-Temperaturmessung : Datenerfassung in der Grenzfläche zwischen Werkzeug und Werkstück bzw. Schmelze
In: Vakuum in Forschung und Praxis, 30 (6), 28-33, 2018
[DOI: 10.1002/vipr.201800699]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher (Corresponding author)
Stalpers, Lore
Janowitz, Julia
Einfluss der Bindereigenschaften und -zersetzung auf die Lötnahtqualität beim großflächigen Fügen mit Lotpasten
In: Schweissen und Schneiden, 70 (6), 390-394, 2018
Bobzin, Kirsten
Öte, Mehmet
Wiesner, Stefanie
Hebing, Julian (Corresponding author)
Effect of Heat Treatment on the Phase Composition, Microstructure and Mechanical Properties of Al0.6CrFeCoNi and Al0.6CrFeCoNiSi0.3 High-Entropy Alloys
In: Metals : open access journal, 8 (11), 974, 2018
[DOI: 10.3390/met8110974]
Chen, Lijia
Bobzin, Kirsten
Zhou, Zheng (Corresponding author)
Zhao, Lidong
Öte, Mehmet
Königstein, Tim Denis Stefan
Tan, Zhen
He, Dingyong
Einfluss verunreinigter Oberflächenzustände auf das Benetzungsverhalten des Lots Ni 620 auf dem Grundwerkstoff 1.4301
In: Schweissen und Schneiden, 70 (8), 566-570, 2018
Tillmann, Wolfgang (Corresponding author)
Eilers, Arne (Corresponding author)
Wojarski, Lukas (Corresponding author)
Manka, Matthias (Corresponding author)
Bobzin, Kirsten (Corresponding author)
Öte, Mehmet (Corresponding author)
Wiesner, Stefanie (Corresponding author)
Entwicklung von HPPMS‐Al2O3‐Beschichtungen für die Zerspanung von schwer zerspanbaren Werkstoffen
In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 49 (11), 1287-1300, 2018
[DOI: 10.1002/mawe.201800008]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher (Corresponding author)
Bastürk, Serhan
Klocke, Fritz
Gerschwiler, Klaus
Kölker, W.
Bolz, S.
Kohlscheen, J.
Enhanced PVD process control by online substrate temperature measurement
In: Surface and coatings technology, 354, 383-389, 2018
[DOI: 10.1016/j.surfcoat.2018.07.096]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher (Corresponding author)
Laser-structured high performance PVD coatings
In: Surface and coatings technology, 352, 302-312, 2018
[DOI: 10.1016/j.surfcoat.2018.07.094]
Bobzin, Kirsten
Brögelmann, Tobias
Gillner, Arnold
Kruppe, Nathan Christopher
He, Chao
Naderi, Mona
A contribution to the thermal effects of DLC coatings on fluid friction in EHL contacts
In: Lubrication science, 30 (6), 285-299, 2018
[DOI: 10.1002/ls.1421]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Thiex, Matthias (Corresponding author)
Ebner, M.
Lohner, T.
Stahl, K.
Thick HS-PVD (Al,Cr)2O3 coatings for challenging cutting and die casting applications
In: Thin solid films, 663, 131-142, 2018
[DOI: 10.1016/j.tsf.2018.06.061]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Welters, Martin (Corresponding author)
Investigations on the substrate bias influence on reactive HPPMS plasmas
In: Thin solid films, 663, 62-72, 2018
[DOI: 10.1016/j.tsf.2018.07.048]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Engels, Martin Gottfried (Corresponding author)
Al-Si and Al-Si-Y coatings deposited by HS-PVD for the oxidation protection of γ-TiAl
In: Surface and coatings technology, 350, 587-595, 2018
[DOI: 10.1016/j.surfcoat.2018.06.074]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Liang, Tiancheng (Corresponding author)
In situ investigation of production processes in a large chamber scanning electron microscope
In: Ultramicroscopy, 193, 151-158, 2018
[DOI: 10.1016/j.ultramic.2018.07.002]
Aretz, Anke
Ehle, Lisa Christine
Häusler, André
Bobzin, Kirsten
Öte, Mehmet
Wiesner, Stefanie
Schmidt, Alexander
Gillner, Arnold
Poprawe, Reinhart
Mayer, Joachim (Corresponding author)
Correlation of HPPMS plasma and coating properties using artificial neural networks
In: Surface and coatings technology, 349, 1130-1136, 2018
[DOI: 10.1016/j.surfcoat.2018.06.065]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa
Engels, Martin Gottfried (Corresponding author)
Tribological studies on self-lubricating (Cr,Al)N+Mo:S coatings at elevated temperature
In: Surface and coatings technology, 353, 282-291, 2018
[DOI: 10.1016/j.surfcoat.2018.06.067]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Hoffmann, Dennis Christopher (Corresponding author)
Klocke, Fritz
Mattfeld, Patrick-Marcel
Trauth, Daniel
Hild, Rafael
Reibungsreduzierung durch gradierte diamantähnliche Kohlenstoffschichten in EHD-Kontakten des Automobilantriebsstrangs
In: Tribologie und Schmierungstechnik, 65 (1), 66-68, 2018
Brögelmann, Tobias
12. Aachener Oberflächentechnik Kolloquium : Bericht über die Veranstaltung am 8. Dezember 2017 in Aachen
In: Galvanotechnik, 109 (3), 538-539, 2018
Bobzin, Kirsten
High temperature oxidation behavior of Al0.6CrFeCoNi and Al0.6CrFeCoNiSi0.3 high entropy alloys
In: Journal of alloys and compounds, 764, 845-852, 2018
[DOI: 10.1016/j.jallcom.2018.06.036]
Chen, Lijia
Zhou, Zheng (Corresponding author)
Tan, Zhen
He, Dingyong
Bobzin, Kirsten
Zhao, Lidong
Öte, Mehmet
Königstein, Tim Denis Stefan
Physical Vapour Deposition : Hartstoffbeschichtungen für die Verarbeitung von Polymethylmethacrylat
In: Galvanotechnik : Fachzeitschrift für die Praxis der Oberflächenbehandlung: Photovoltaik, Dünnschicht- und Plasmatechnik, Mikrosystemtechnik und Umwelttechnik, 109 (5), 873-884, 2018
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Naderi, Mona
Development of HVAF-sprayed novel Fe-based coatings for large area applications
In: Thermal spray bulletin, 11 (1), 38-45, 2018
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Sommer, Jan
Prozessgrenzen beim Honen thermischer Spritzschichten : Honen korrosionsbeständiger und reibverlustmindernder Eisenbasisschichten für Bohrungsanwendungen
In: wt Werkstattstechnik online, 1/2, 63-66, 2018
Dröder, Klaus
Hoffmeister, Hans-Werner
Mahlfeld, Georg (Corresponding author)
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan (Corresponding author)
Wank, Andreas (Corresponding author)
Schläfer, Thomas
Wessler, Tobias
Space-resolved plasma diagnostics in a hybrid (Cr,Al)N process
In: Journal of vacuum science & technology / A, 36 (3), 031515, 2018
[DOI: 10.1116/1.5020151]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Engels, Martin Gottfried (Corresponding author)
Einfluss von Oberflächenstrukturierungen auf die Stempelkraft beim Vollvorwärtsfließpressen von 16MnCr5
In: Dry metal forming open access journal, 4, 25-30, 2017
Klocke, Fritz
Hild, Rafael (Corresponding author)
Trauth, Daniel
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Hoffmann, Dennis Christopher
Developmement of Novel Fe-Based Coating Systems for Internal Combustion Engines
In: Journal of thermal spray technology : JTST, 27 (4), 736-745, 2018
[DOI: 10.1007/s11666-018-0705-3]
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan (Corresponding author)
Dröder, Klaus
Hoffmeister, Hans-Werner
Mahlfeld, Georg
Schäfer, Thomas
Effect of Alloying Elements on Growth Behavior of Intermetallic Compounds at the Cold-Sprayed Coating/Steel Interface During Immersion in Aluminum Melt
In: International journal of metalcasting : IJMC, 12 (4), 712-721, 2018
[DOI: 10.1007/s40962-017-0205-0]
Bobzin, Kirsten
Öte, Mehmet
Wiesner, Stefanie
Gerdt, Leonid (Corresponding author)
Bührig-Polaczek, Andreas
Brachmann, Johannes
A novel approach for the prediction of deformation and fracture in hard coatings : Comparison of numerical modeling and nanoindentation tests
In: Mechanics of materials, 117, 192-201, 2017
[DOI: 10.1016/j.mechmat.2017.11.006]
Rezaei, Shahed (Corresponding author)
Arghavani, Mostafa
Wulfinghoff, Stephan
Kruppe, Nathan Christopher
Brögelmann, Tobias
Reese, Stefanie
Bobzin, Kirsten
Transfer of Wire Arc-Sprayed Metal Coatings onto Plastic Parts
In: Journal of thermal spray technology, 27 (1-2), 119-134, 2017
[DOI: 10.1007/s11666-017-0667-x]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Liao, Xifang (Corresponding author)
Hopmann, Christian
Ochotta, Philipp
Replication of micro-structured injection molds using physical vapor deposition coating and dynamic laser mold tempering
In: Journal of polymer engineering, 38 (3), 315-322, 2017
[DOI: 10.1515/polyeng-2017-0131]
Hopmann, Christian
Bobzin, Kirsten
Brögelmann, Tobias
Orth, Magnus Johannes (Corresponding author)
Kruppe, Nathan Christopher
Naderi, Mona
Impact wear of an HVOF-sprayed Cr3C2-NiCr coating
In: International journal of refractory metals & hard materials, 70, 191-196, 2017
[DOI: 10.1016/j.ijrmhm.2017.10.011]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Öte, Mehmet
Königstein, Tim Denis Stefan
Steeger, Martin
Tribologischer Einsatz eisenbasierter Wärmedämmschichten in Verbrennungsmotoren
In: Tribologie und Schmierungstechnik, 64 (3), 5-10, 2017
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan
Yao, Haihau
Mechanical and tribological characterization of self-lubricating (Cr1-xAlx)N coatings for deposition on complex-shaped forging tools
In: Dry metal forming open access journal, 3, 81-89, 2017
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa
Hoffmann, Dennis Christopher
Klocke, Fritz
Mattfeld, Patrick-Marcel
Trauth, Daniel
Hild, Rafael (Corresponding author)
Korrelation der Haftzugfestigkeit thermisch gespritzter Beschichtungen mit der Substrattopografie
In: Thermal spray bulletin, 10 (2), 118-125, 2017
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Sommer, Jan (Corresponding author)
Beschichtungen für stoff- und formschlüssige Al-Schmelze/Stahlblech-Hybridbauteile
In: Jahrbuch Oberflächentechnik, 73, 139-145, 2017
Bobzin, Kirsten
Bührig-Polaczek, Andreas
Öte, Mehmet
Wiesner, Stefanie
Gerdt, Leonid (Corresponding author)
Brachmann, Johannes
Physical Vapour Deposition : Hartstoffbeschichtungen für die Verarbeitung von Polymethylmethacrylat
In: Jahrbuch Oberflächentechnik, 73, 116-127, 2017
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Naderi, Mona
High temperature oxidation protection of γ-titanium aluminide using (Cr,Al)ON coatings deposited by high-speed physical vapor deposition
In: Surface and coatings technology, 332, 2-11, 2017
[DOI: 10.1016/j.surfcoat.2017.09.071]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Liang, Tiancheng (Corresponding author)
Correlation of the Debye sheath thickness and (Cr,Al)N coating properties for HPPMS, dcMS, CAE and PCAE processes
In: Surface and coatings technology, 332, 233-241, 2017
[DOI: 10.1016/j.surfcoat.2017.06.091]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Engels, Marita (Corresponding author)
Advanced deposition of hard a-C:Me coatings by HPPMS using Ne as process gas
In: Surface and coatings technology, 332, 242-252, 2017
[DOI: 10.1016/j.surfcoat.2017.07.089]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Engels, Martin Gottfried (Corresponding author)
Plastic deformation behavior of nanostructured CrN/AlN multilayer coatings deposited by hybrid dcMS/HPPMS
In: Surface and coatings technology, 332, 253-261, 2017
[DOI: 10.1016/j.surfcoat.2017.06.092]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa (Corresponding author)
Mayer, Joachim
Weirich, Thomas E.
11. Aachener Oberflächentechnik Kolloquium
In: Galvanotechnik, 108, 1224-1225, 2017
Bobzin, Kirsten
Triboactive CrAlN+X hybrid dcMS/HPPMS PVD nitride hard coatings for friction and wear reduction on components
In: Surface and coatings technology, 332, 452-463, 2017
[DOI: 10.1016/j.surfcoat.2017.06.089]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian (Corresponding author)
Microstructural analysis of germanium modified tin-copper brazing filler metals for transient liquid phase bonding of aluminium
In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 48 (12), 1257-1263, 2017
[DOI: 10.1002/mawe.201700155]
Iskandar, Mohamad Riza (Corresponding author)
Schwedt, Alexander
Mayer, Joachim
Rochala, Patrick
Wiesner, Stefanie
Öte, Mehmet
Bobzin, Kirsten
Weirich, Thomas E.
Formation of the reaction zone between tin-copper brazing fillers and aluminum-silicon-magnesium alloys : Experiments and thermodynamic analysis
In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 48 (12), 1241-1248, 2017
[DOI: 10.1002/mawe.201700152]
Bobzin, Kirsten
Öte, Mehmet
Wiesner, Stefanie
Schmidt, Alexander (Corresponding author)
Apel, M.
Berger, R.
Aretz, Anke
Mayer, Joachim
Residual stress measurement in AlSi alloys
In: Materialwissenschaft und Werkstofftechnik = Materialwissenschaft und Werkstofftechnik, 48 (12), 1270-1275, 2017
[DOI: 10.1002/mawe.201700157]
Reisgen, Uwe
Sharma, Rahul (Corresponding author)
Gach, Stefan
Olschok, Simon
Francis, J.
Bobzin, Kirsten
Öte, Mehmet
Wiesner, Stefanie
Knoch, Martin Andreas
Schmidt, Alexander
Correlative plasma-surface model for metastable Cr-Al-N: Frenkel pair formation and influence of the stress state on the elastic properties
In: Journal of applied physics, 121 (21), 215108, 2017
[DOI: 10.1063/1.4985172]
Music, Denis (Corresponding author)
Banko, Lars
Rueß, Holger
Engels, Martin Gottfried
Hecimovic, Ante
Grochla, Dario
Rogalla, Detlef
Brögelmann, Tobias
Ludwig, Alfred
von Keudell, Achim
Bobzin, Kirsten
Schneider, Jochen M.
Thermal Conductivity and Wear Behavior of HVOF-Sprayed Fe-Based Amorphous Coatings
In: Coatings : open access journal, 7 (10), 173, 2017
[DOI: 10.3390/coatings7100173]
Yao, Haihua
Zhou, Zheng (Corresponding author)
Wang, Liang
Tan, Zhen
He, Dingyong
Zhao, Lidong
Enhanced replication ratio of injection molded plastic parts by using an innovative combination of laser-structuring and PVD coating
In: Surface and coatings technology, 332, 474-483, 2017
[DOI: 10.1016/j.surfcoat.2017.09.068]
Bobzin, Kirsten
Hopmann, Christian
Gillner, Arnold
Brögelmann, Tobias
Kruppe, Nathan Christopher
Orth, Magnus Johannes
Steger, Michael
Naderi, Mona (Corresponding author)
Entwicklung einer neuartigen wirtschaftlichen, eisenbasierten Beschichtung zur Erhöhung der Lebensdauer von Gussbauteilen unter dem Gesichtspunkt der Korrosionsbeständigkeit
In: Materialwissenschaft und Werkstofftechnik, 48 (9), 922-935, 2017
[DOI: 10.1002/mawe.201700165]
Bobzin, Kirsten
Zhao, Lidong
Öte, Mehmet
Königstein, Tim Denis Stefan
Oechsner, M.
Siebers, M. (Corresponding author)
Andersohn, G.
Ellermeier, J.
A Contribution to explain the Mechanisms of Adhesive Wear in Plastics Processing by example of Polycarbonate
In: Surface and coatings technology, 332, 464-473, 2017
[DOI: 10.1016/j.surfcoat.2017.07.080]
Bobzin, Kirsten
Brögelmann, Tobias
Grundmeier, Guido
de los Arcos, Teresa
Wiesing, M.
Kruppe, Nathan Christopher (Corresponding author)
Simulation of the Particel Melting Degree in air Plasma Spraying
In: Journal of physics / Conference Series, 825, 012002, 2017
[DOI: 10.1088/1742-6596/825/1/012002]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Alkhasli, Ilkin (Corresponding author)
Reisgen, Uwe
Mokrov, Oleg
Lisnyi, Oleksii
Kunststoffe metallisieren
In: KunststoffXtra : Fachberichte, Messen, News, 7 (1/2), 11-15, 2017
Hopmann, Christian
Ochotta, Philipp (Corresponding author)
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Liao, Xifang
Fundamental study of an industrial reactive HPPMS (Cr,Al)N process
In: Journal of applied physics, 122 (1), 015302, 2017
[DOI: 10.1063/1.4990997]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Engels, Martin Gottfried (Corresponding author)
von Keudell, A.
Hecimovic, A.
Ludwig, A.
Grochla, Dario
Banko, Lars
Mechanical and tribiological characterization of self-lubricating (Cr1-xAlx)N coatings for deposition on complex-shaped forging tools
In: Dry metal forming open access journal, 3, 81-89, 2017
[DOI: 10.18154/RWTH-2017-06971]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa (Corresponding author)
Hoffmann, Dennis Christopher
Klocke, Fritz
Mattfeld, Patrick-Marcel
Trauth, Daniel
Hild, Rafael
Investigations on Mechanical and Tribological Behavior of dcMS/HPPMS CrN and (Cr,Al)N Hard Coatings Using Nanoscratch Technique
In: Advanced engineering materials, 19 (6), 1600632, 2017
[DOI: 10.1002/adem.201600632]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa (Corresponding author)
Nitridische und oxinitridische HPPMS-Beschichtungen für den Einsatz in der Kunststoffverarbeitung (Teil 2) : Einfluss einer Sauerstoffvariation in (Cr,Al)ON-Beschichtungen auf die chemische Zusammensetzung der nativen Reaktionsschicht, sowie das Benetzungsverhalten gegenüber geschmolzenem und die Haftzugfestigkeit von erstarrtem Polycarbonat
In: Vakuum in Forschung und Praxis, 29 (1), 24-28, 2017
[DOI: 10.1002/vipr.201700634]
Bobzin, Kirsten
Grundmeier, Guido
Brögelmann, Tobias
de los Arcos, Teresa
Wiesing, Martin
Kruppe, Nathan Christopher (Corresponding author)
High-rate deposition of thick (Cr,Al)ON coatings by high speed physical vapor deposition
In: Surface and coatings technology, 322, 152-162, 2017
[DOI: 10.1016/j.surfcoat.2017.05.034]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Liang, Tiancheng (Corresponding author)
Thermal cycling and isothermal oxidation behavior of quadruple EB-PVD thermal barrier coatings
In: Materialwissenschaft und Werkstofftechnik, 48 (6), 502-518, 2017
[DOI: 10.1002/mawe.201600723]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Yildirim, Baycan
Welters, Martin (Corresponding author)
How dry is dry? A critical analysis of surface conditions used in dry metal forming
In: Dry metal forming open access journal, 3, 90-94, 2017
Almohallami, Amer
Arghavani, Mostafa
Böhmermann, F.
Freiße, H.
Herrmann, M.
Mousavi, S. A.
Schöler, S.
Scholz, P.
Tenner, J.
Umlauf, Georg
Teller, Marco
Wulff, D.
Yilkiran, D.
Maier, Hans Jürgen (Corresponding author)
Untersuchung der Einflussfaktoren auf die Übertragung von lichtbogendrahtgespritzten Zn-Beschichtungen für die Metallisierung von Kunststoffbauteilen
In: Thermal spray bulletin, 10 (1), 43-49, 2017
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas
Liao, Xifang
Hopmann, Christian
Ochotta, Philipp
Trockenumformung von 42CrS4 mittels Vollvorwärtsfließpressen durch strukturierte Halbzeugoberflächen und selbstschmierende Werkzeugbeschichtungen
In: Dry metal forming open access journal, 4, 7-12, 2017
[DOI: 10.18154/RWTH-2017-04884]
Klocke, Fritz
Hild, Rafael (Corresponding author)
Trauth, Daniel
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa
Numerical Study on Plasma Jet and Particle Behavior in Multi-arc Plasma Spraying
In: Journal of thermal spray technology : JTST, 26 (5), 811-830, 2017
[DOI: 10.1007/s11666-017-0564-3]
Bobzin, Kirsten
Öte, Mehmet (Corresponding author)
Schein, J.
Zimmermann, S.
Numerical Coupling of the Particulate Phase to the Plasma Phase in Modeling of Multi-Arc Plasma Spraying
In: Journal of physics / Conference Series, 825, 012003, 2017
[DOI: 10.1088/1742-6596/825/1/012003]
Bobzin, Kirsten
Öte, Mehmet (Corresponding author)
High-performance coatings for cutting tools
In: CIRP journal of manufacturing science and technology : CIRP-JMST, 18, 1-9, 2016
[DOI: 10.1016/j.cirpj.2016.11.004]
Bobzin, Kirsten (Corresponding author)
Investigation of Amorphous/Nanocrystalline Iron-Based Thermal Barrier Coatings
In: Journal of thermal spray technology : JTST, 26 (3), 388-397, 2017
[DOI: 10.1007/s11666-016-0520-7]
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan (Corresponding author)
Influence of Feedstock Materials and Spray Parameters on Thermal Conductivity of Wire-Arc-Sprayed Coatings
In: Journal of materials engineering and performance, 26 (3), 1108-1113, 2017
[DOI: 10.1007/s11665-017-2567-0]
Yao, H. H.
Zhou, Zhe (Corresponding author)
Wang, G. H.
He, D. Y.
Bobzin, Kirsten
Zhao, Lidong
Öte, Mehmet
Königstein, Tim Denis Stefan
Microstructure and Properties of FeCrB Alloy Coatings Prepared by Wire-Arc Spraying
In: Journal of thermal spray technology : JTST, 26 (3), 483-491, 2017
[DOI: 10.1007/s11666-016-0510-9]
Yao, H. H.
Zhou, Zhe (Corresponding author)
Wang, Yu-Ming
He, D. Y.
Bobzin, Kirsten
Zhao, Lidong
Öte, Mehmet
Königstein, Tim Denis Stefan
Surface Pre-treatment for Thermally Sprayed ZnAl15 Coatings
In: Journal of thermal spray technology : JTST, 26 (3), 464-472, 2017
[DOI: 10.1007/s11666-016-0507-4]
Bobzin, Kirsten
Öte, Mehmet
Knoch, Martin Andreas (Corresponding author)
Modeling Plasma-Particle Interaction in Multi-Arc Plasma Spraying
In: Journal of thermal spray technology : JTST, 26 (3), 279-291, 2017
[DOI: 10.1007/s11666-016-0514-5]
Bobzin, Kirsten
Öte, Mehmet (Corresponding author)
Characterization of DC magnetron plasma in Ar/Kr/N 2 mixture during deposition of (Cr,Al)N coating
In: Journal of physics / D, Applied physics, 50 (7), 075203, 2017
[DOI: 10.1088/1361-6463/aa4ea2]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, S.
Brugnara, Ricardo H.
Bibinov, N. (Corresponding author)
Awakowicz, P.
Influence of long time post annealing on thermal stability and thermophysical properties of plasma sprayed La2Zr2O7 coatings
In: Journal of alloys and compounds : JAL, 695, 2549-2555, 2016
[DOI: 10.1016/j.jallcom.2016.10.328]
Erdogan, Garip (Corresponding author)
Ustel, Fatih
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Zhao, Lidong
Evaluation of the shear stresses on surface structured workpieces in dry forming using a novel pin-on-cylinder tribometer with axial feed
In: International journal of material forming, 10 (4), 557-565, 2016
[DOI: 10.1007/s12289-016-1301-z]
Trauth, Daniel (Corresponding author)
Bastürk, Serhan
Hild, Rafael
Mattfeld, Patrick-Marcel
Brögelmann, Tobias
Bobzin, Kirsten
Klocke, Fritz
Novel Fe-based wear and corrosion resistant coatings by three-cathode plasma technology
In: Surface and coatings technology, 318, 288-292, 2016
[DOI: 10.1016/j.surfcoat.2016.08.041]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Öte, Mehmet
Königstein, Tim Denis Stefan
Nitridische und oxinitridische HPPMS-Beschichtungen für den Einsatz in der Kunststoffverarbeitung (Teil 1) : Einfluss einer Sauerstoffvariation auf Schichteigenschaften von (Cr,Al)ON und Verbundeigenschaften zwischen Beschichtung und Kunststoffformenstahl
In: Vakuum in Forschung und Praxis, 28 (6), 28-33, 2016
[DOI: 10.1002/vipr.201600632]
Bobzin, Kirsten
Grundmeier, Guido
Brögelmann, Tobias
de los Arcos, Teresa
Wiesing, Martin
Kruppe, Nathan Christopher (Corresponding author)
Reactive Air Brazing
In: Info-Service (34), 2-6, 2016
Kopp, Nils
Bobzin, Kirsten
Wiesner, Stefanie
TiC-verstärkte, stahlbasierte Werkstoffverbunde und innovative Implementierung im thermischen Spritzen
In: Dialog, 5, 92-102, 2016
Bobzin, Kirsten
Zhao, Lidong
Öte, Mehmet
Link, Thomas
On the plastic deformation of chromium-based nitride hard coatings deposited by hybrid dcMS/HPPMS: A fundamental study using nanoscratch test
In: Surface and coatings technology, 308, 298-306, 2016
[DOI: 10.1016/j.surfcoat.2016.05.093]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa (Corresponding author)
Mayer, Joachim
Weirich, Thomas E.
Synthesis of a-C coatings by HPPMS using Ar, Ne and He as process gases
In: Surface and coatings technology, 308, 80-89, 2016
[DOI: 10.1016/j.surfcoat.2016.07.099]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian
Engels, Marita (Corresponding author)
Influence of dcMS and HPPMS in a dcMS/HPPMS hybrid process on plasma and coating properties
In: Thin solid films, 620, 188-196, 2016
[DOI: 10.1016/j.tsf.2016.07.079]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Engels, Martin Gottfried (Corresponding author)
Thermisch gespritzte Gleitlagerwerkstoffe für die Rotorlagerung von Windenergieanlagen
In: Ingenieur-Spiegel : Fachmagazin für Ingenieure / Hellblaue Ausgabe, 2016 (4), 28-29, 2016
Schröder, Tim (Corresponding author)
Jacobs, Georg
Bosse, Dennis
Bobzin, Kirsten
Öte, Mehmet
Königstein, Tim Denis Stefan
Wietheger, Wolfgang
Hybrid dcMS/HPPMS PVD nitride and oxynitride hard coatings for adhesion and abrasion reduction in plastics processing
In: Surface and coatings technology, 308, 349-359, 2016
[DOI: 10.1016/j.surfcoat.2016.07.103]
Bobzin, Kirsten
Brögelmann, Tobias
Kalscheuer, Christian (Corresponding author)
Naderi, Mona
Efficiency improvement in automobile bucket tappet/camshaft contacts by DLC coatings : Influence of engine oil, temperature and camshaft speed
In: Surface and coatings technology, 308, 360-373, 2016
[DOI: 10.1016/j.surfcoat.2016.09.041]
Dobrenizki, L.
Tremmel, S.
Wartzack, Sandro
Hoffmann, Dennis Christopher
Brögelmann, Tobias (Corresponding author)
Bobzin, Kirsten
Bagcivan, Nazlim
Musayev, Y.
Hosenfeldt, T.
Analysis of CrN/AlN/Al2O3 and two industrially used coatings deposited on die casting cores after application in an aluminum die casting machine
In: Surface and coatings technology, 308, 374-382, 2016
[DOI: 10.1016/j.surfcoat.2016.09.040]
Bobzin, Kirsten
Brögelmann, Tobias
Hartmann, U.
Kruppe, Nathan Christopher (Corresponding author)
(Cr,Al)N/(Cr,Al)ON Oxy-nitride Coatings deposited by Hybrid dcMS/HPPMS for Plastics Processing Applications
In: Surface and coatings technology, 308, 394-403, 2016
[DOI: 10.1016/j.surfcoat.2016.07.093]
Bobzin, Kirsten
Brögelmann, Tobias
Grundmeier, G.
de los Arcos, Teresa
Wiesing, M.
Kruppe, Nathan Christopher (Corresponding author)
Synthesis, characterization, and tribological evaluation of HPPMS (Cr1 − xAlx)N + MoSy coatings
In: Surface and coatings technology, 308, 383-393, 2016
[DOI: 10.1016/j.surfcoat.2016.07.089]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Bastürk, Serhan
Klocke, Fritz
Mattfeld, Patrick-Marcel
Trauth, Daniel
Hild, Rafael (Corresponding author)
Influence of Boron Content on Microstructure and Properties of Wire-arc Sprayed Fe-based Coatings
In: Thermal spray bulletin, 9 (1), 60-68, 2016
Yao, Haihua
Zhou, Zheng
Wang, Yiming
He, Ding-Young
Bobzin, Kirsten
Zhao, Lidong
Öte, Mehmet
Linke, Thomas Frederik
Königstein, Tim Denis Stefan
Thermisch gespritzte Korrosionsschutzschichten, eine Ergänzung zur Feuerverzinkung!
In: WOMag : Kompetenz in Werkstoff und funktioneller Oberfläche, 5 (6), 41, 2016
[DOI: 10.7395/2016/Knoch01]
Bobzin, Kirsten
Öte, Mehmet
Schulz, Christiane
Knoch, Martin Andreas
Tribologisches Verhalten von eisenbasierten Titankarbid verstärkten thermisch gespritzten Schichten
In: Tribologie und Schmierungstechnik, 5, 19-24, 2016
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Malik, Katarzyna
Königstein, Tim Denis Stefan
Process Development for Innovative Iron Alloy Metallic Glass Coatings
In: Advanced engineering materials, 18 (10), 1833-1840, 2016
[DOI: 10.1002/adem.201600177]
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Königstein, Tim Denis Stefan (Corresponding author)
Effect of long-term heat-treatment at 1150°C on the microstructure and properties of thermal barrier coatings based on ZrO2-4mol.% Y2O3-1mol.% Gd2O3-1mol.% Yb2O3
In: Surface and coatings technology, 318, 142-146, 2016
[DOI: 10.1016/j.surfcoat.2016.06.055]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Öte, Mehmet
Königstein, Tim Denis Stefan
Investigation of Reactive HPPMS Process and Influence of Bias Voltage during Deposition of Alumina Coatings
In: Advanced engineering materials, 18 (4), 665-670, 2016
[DOI: 10.1002/adem.201500417]
Bobzin, Kirsten
Brögelmann, Tobias
Brugnara, Ricardo H.
Bastürk, Serhan (Corresponding author)
Bagcivan, Nazlim
Influence of HPPMS pulse parameters on the reactive gas N2 and on the properties of (Cr, Al)N coatings
In: Surface and coatings technology, 293, 28-34, 2015
[DOI: 10.1016/j.surfcoat.2015.12.072]
Bobzin, Kirsten
Brögelmann, Tobias
Brugnara, Ricardo H.
Kruppe, Nathan Christopher (Corresponding author)
Chromy, Stephan
Modelling the Plasma Jet in Multi-Arc Plasma Spraying
In: Journal of thermal spray technology : JTST, 25 (6), 1111-1126, 2016
[DOI: 10.1007/s11666-016-0438-0]
Bobzin, Kirsten
Öte, Mehmet (Corresponding author)
Schein, J.
Zimmermann, Stephan
Möhwald, K.
Lummer, C.
Drei Mikrometer Hightech - Einsatz von PVD-Beschichtungen zur Verbesserung des Extrusionsprozesses
In: Kunststoffe , 106 (7), 62-65, 2016
Hopmann, Christian
Höfs, Christopher Frederic (Corresponding author)
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Naderi, Mona
Minimizing Frictional Losses in Crankshaft Bearings of Automobile Powertrain by Diamond-like Carbon Coatings under Elasto-hydrodynamic Lubrication
In: Surface and coatings technology, 290, 100-109, 2016
[DOI: 10.1016/j.surfcoat.2015.08.064]
Bobzin, Kirsten
Brögelmann, Tobias (Corresponding author)
Verformungsverhalten nanostrukturierter HPPMS-Hartstoffschichten
In: Vakuum in Forschung und Praxis, 28 (3), 18-25, 2016
[DOI: 10.1002/vipr.201600604]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa (Corresponding author)
Thermische Auslagerung eines mehrlagigen Oxidationsschutz-Beschichtungssystems für γ-Titaniumaluminide
In: Thermal spray bulletin, 9 (1), 34-40, 2016
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
HPPMS (Cr1-xAlx)N+WSy Coatings for the Application in Dry Cold Forging of Steel: Synthesis and Raman Characterization
In: Dry metal forming open access journal, 2, 72-77, 2016
[DOI: 10.18154/RWTH-2016-04878]
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Arghavani, Mostafa
Bastürk, Serhan (Corresponding author)
Klocke, Fritz
Mattfeld, Patrick
Trauth, Daniel
Hild, Rafael
Recommendations for Dry Forming of 16MnCr5 and 42CrMo4 in Cold Forging
In: Dry metal forming open access journal, 2, 44-49, 2016
[DOI: 10.18154/RWTH-2016-04874]
Klocke, Fritz
Hild, Rafael (Corresponding author)
Trauth, Daniel
Mattfeld, Patrick
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Influence of the Composition on the Properties of (Cr 1-x Al x )N/Mo y S z PVD Coatings
In: Advanced engineering materials, 18 (6), 1036-1043, 2016
[DOI: 10.1002/adem.201500499]
Bobzin, Kirsten
Brögelmann, Tobias
Bastürk, Serhan (Corresponding author)
Klocke, Fritz
Mattfeld, Patrick
Trauth, Daniel
Polcik, Peter
Kolozsvári, Szilárd
In-Mould-Metal-Spraying - Surface and partial metallisation of plastic parts
In: European tool & mould making : ETMM, 18 (5), 38-39, 2016
Hopmann, Christian
Bobzin, Kirsten
Ochotta, Philipp (Corresponding author)
Öte, Mehmet
Knoch, Martin Andreas
Liao, Xifang
Modeling Multi-arc Spraying Systems
In: Journal of thermal spray technology, 25 (5), 920-932, 2016
[DOI: 10.1007/s11666-016-0407-7]
Bobzin, Kirsten
Öte, Mehmet (Corresponding author)
Improved molding of micro structures using PVD-coated mold inserts
In: Journal of Polymer Engineering, 36 (6), 575-582, 2015
[DOI: 10.1515/polyeng-2015-0270]
Hopmann, Christian
Bobzin, Kirsten
Brögelmann, Tobias
Schäfer, Christian
Schöngart, Maximilian
Röbig, Malte (Corresponding author)
Naderi, Mona
Wear and Corrosion Resistance of Fe-Based Coatings Reinforced by TiC Particles for Application in Hydraulic Systems
In: Journal of thermal spray technology, 25 (1), 365-374, 2015
[DOI: 10.1007/s11666-015-0316-1]
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik (Corresponding author)
Malik, Katarzyna
Influence of Process Parameter on Grit Blasting as a Pretreatment Process for Thermal Spraying
In: Journal of thermal spray technology, 25 (1), 3-11, 2015
[DOI: 10.1007/s11666-015-0297-0]
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Sommer, Jan
Liao, Xifang (Corresponding author)
IMKS and IMMS : two methods for the production of plastic parts featuring metallic areas
In: Journal of polymer engineering, 36 (6), 549-556, 2015
[DOI: 10.1515/polyeng-2014-0281]
Hopmann, Christian
Bobzin, Kirsten
Schoeldgen, Roman
Öte, Mehmet
Wunderle, Johannes
Linke, Thomas F.
Ochotta, Philipp (Corresponding author)
In-Mould-Metal-Spraying - Neuer Verfahrensansatz zur Metallisierung von Kunststoffbauteilen
In: Werkstoffe in der Fertigung, 52 (2), 16-17, 2015
Hopmann, Christian
Bobzin, Kirsten
Ochotta, Philipp
Öte, Mehmet
Linke, Thomas Frederik
Liao, Xifang
Aluminum-rich HPPMS (Cr1−xAlx)N coatings deposited with different target compositions and at various pulse lengths
In: Vacuum : surface engineering, surface instrumentation & vacuum technology, 122 (Part A), 201-207, 2015
[DOI: 10.1016/j.vacuum.2015.09.028]
Bobzin, Kirsten
Brögelmann, Tobias
Brugnara, R. H. (Corresponding author)
CrN/AlN and CrN/AlN/Al2O3 coatings deposited by pulsed cathodic arc for aluminum die casting applications
In: Surface and coatings technology, 284, 222-229, 2015
[DOI: 10.1016/j.surfcoat.2015.07.074]
Bobzin, Kirsten
Brögelmann, Tobias
Brugnara, R. H.
Kruppe, Nathan Christopher (Corresponding author)
Analysis of ion energy distribution at the substrate during a HPPMS (Cr,Al)N process using retarding field energy analyzer and energy resolved mass spectrometer
In: Thin solid films, 596, 140-146, 2015
[DOI: 10.1016/j.tsf.2015.08.059]
Bobzin, Kirsten
Brögelmann, Tobias
Brugnara, Ricardo H.
Chromy, S. (Corresponding author)
Investigation on Plastic Behavior of HPPMS CrN, AIN and CrN/AIN-Multilayer Coatings using Finite Element Simulation and Nanoindentation
In: Surface and coatings technology, 284, 310-317, 2015
[DOI: 10.1016/j.surfcoat.2015.07.081]
Bobzin, Kirsten
Brögelmann, Tobias
Brugnara, Ricardo H.
Arghavani, Mostafa (Corresponding author)
Yang, T.-S.
Chang, Y.-Y.
Chang, S.-Y.
Metallisierung von Kunststoffoberflächen - ein neues Verfahren: "In-Mould Metal Spraying (IMMS)"
In: Jahrbuch Oberflächentechnik, 71, 68-73, 2015
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Liao, Xifang
Hopmann, Christian
Ochotta, Philipp (Corresponding author)
Influence of wetting and thermophysical properties of diamond-like carbon coatings on the frictional behavior in automobile gearboxes under elasto-hydrodynamic lubrication
In: Surface and coatings technology, 248, 290-301, 2015
[DOI: 10.1016/j.surfcoat.2015.06.087]
Bobzin, Kirsten
Brögelmann, Tobias (Corresponding author)
Stahl, Karsten
Stemplinger, Johann-Paul
Mayer, Josef
Hinterstoißer, M.
Application of thermal spraying for the manufacture of metal/plastic components
In: Thermal Spray Bulletin, 8 (1), 2-5, 2015
Bobzin, Kirsten
Liao, Xifang
Linke, Thomas Frederik
Öte, Mehmet
Hopmann, Christian
Ochotta, Philipp
Numerical Analysis of the Tribological Mode of Action in Cold Forming of Sinus Waved Surface Structures
In: Dry metal forming open access journal, 1, 137-142, 2015
Klocke, Fritz
Trauth, Daniel
Hild, Rafael (Corresponding author)
Mattfeld, Patrick
Bobzin, Kirsten
Brögelmann, Tobias
Bastürk, Serhan
Tribological Behavior of (Cr1-xAlc)N/WSy PVD Tool Coatings for the Application in Dry Cold Forging of Steel
In: Dry metal forming open access journal, 1, 152-158, 2015
Bobzin, Kirsten
Brögelmann, Tobias
Kruppe, Nathan Christopher
Bastürk, Serhan (Corresponding author)
Klocke, Fritz
Mattfeld, Patrick
Trauth, Daniel
Metallisierung von Kunststoffoberflächen - ein neues Verfahren: "In-Mould Metal Spraying (IMMS)"
In: Jahrbuch Oberflächentechnik, 71, 67-73, 2015
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Liao, Xifang
Hopmann, Christian
Ochotta, P.
Iron-based, titanium-carbide-reinforced thermally sprayed coatings for hydraulic systems
In: Thermal spray bulletin, 8 (2), 148-155, 2015
Bobzin, Kirsten (Corresponding author)
Öte, Mehmet (Corresponding author)
Linke, Frederik (Corresponding author)
Malik, Katarzyna
A Numerical Investigation : Air Plasma Spraying by Means of a Three-Cathode Spraying Torch
In: Thermal spray bulletin, 8 (2), 118-125, 2015
Bobzin, Kirsten
Öte, Mehmet
Hochleistungsplasmen zur Synthese diamantähnlicher Kohlenstoffschichten : Einfluss verschiedener Prozessgase und HPPMS-Pulsparameter auf die Plasmaeigenschaften
In: Vakuum in Forschung und Praxis, 27 (5), 22-28, 2015
[DOI: 10.1002/vipr.201500591]
Bobzin, Kirsten
Brögelmann, Tobias
Bastürk, Serhan
Engels, Martin Gottfried (Corresponding author)
Impulse geben : Kooperation für innovative Entwicklungen ; IOT und CemeCon
In: Facts / Deutsche Ausgabe, 41 (Juli), 9-10, 2015
Bobzin, Kirsten
Brögelmann, Tobias
Bastürk, Serhan
Laserunterstütztes Drehen von thermisch gespritzten WC-10Co-4Cr-Verschleißschutzschichten
In: Thermal spray bulletin, 8 (1), 43-49, 2015
Bobzin, Kirsten (Corresponding author)
Zhao, Lidong (Corresponding author)
Öte, Mehmet (Corresponding author)
Linke, Thomas Frederik (Corresponding author)
Klocke, Fritz
Gräfe, Stefan (Corresponding author)
Arntz, Kristian (Corresponding author)
Brummer, Christoph
Influence of surface treatment on the bond strength of plastics/metal hybrids
In: Zeitschrift Kunststofftechnik, 7, 228-255, 2015
Hopmann, Christian
Wunderle, Johannes
Neuß, Andreas
Ochotta, Philipp
Bobzin, Kirsten
Schulz, Christiane
Liao, Xifang
Wear behaviour of hydrogenated DLC in a pin-on-disc model test under lubrication with different diesel fuel types
In: Tribology international, 92, 12-20, 2015
[DOI: 10.1016/j.triboint.2015.05.020]
Djoufack, Martin H. (Corresponding author)
May, U.
Repphun, G.
Brögelmann, Tobias
Bobzin, Kirsten
Anwendungen des Thermischen Spritzens für die Herstellung von Metall-Kunststoff-Bauteilen
In: Thermal spray bulletin, 8, 28-31, 2015
Bobzin, Kirsten (Corresponding author)
Öte, Mehmet
Linke, Thomas Frederik
Liao, Xifang
Hopmann, Christian
Ochotta, Philipp
Multiscale FE-Studies of Contact Stresses of Dry and Lubricated Shot Peened Workpiece Surfaces
In: Dry metal forming open access journal, 1, 11-16, 2015
Klocke, Fritz
Trauth, Daniel (Corresponding author)
Mattfeld, Patrick
Shirobokov, Anton
Bobzin, Kirsten
Brögelmann, Tobias
Bastürk, Serhan
Development of an in situ Plasma Treatment of X155CrMoV12 for a (Cr,Al)N PVD Tool Coating for Dry Metal Forming in Cold Forging
In: Dry metal forming open access journal, 1, 57-62, 2015
Bobzin, Kirsten
Brögelmann, Tobias
Bastürk, Serhan (Corresponding author)
Klocke, Fritz
Mattfeld, Patrick
Trauth, Daniel
Friction reduction of highly-loaded rolling-sliding contacts by surface modifications under elasto-hydrodynamic lubrication
In: Wear, 328/329, 217-228, 2015
[DOI: 10.1016/j.wear.2015.02.033]
Bobzin, Kirsten
Brögelmann, Tobias (Corresponding author)
Stahl, K.
Michaelis, K.
Mayer, J.
Hinterstoißer, M.
Deposition and characterization of thermal barrier coatings of ZrO2-4 mol.% Y2O3-1 mol.% Gd2O3-1 mol.% Yb2O3
In: Surface and coatings technology, 268, 205-208, 2014
[DOI: 10.1016/j.surfcoat.2014.05.051]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Öte, Mehmet
Linke, Thomas Frederik
Preparation of spherical calcium phosphate granulates suitable for the biofunctionalization of active brazed titanium alloy coatings
In: Biomedizinische Technik = Biomedical engineering, 60 (2), 105-114, 2014
[DOI: 10.1515/bmt-2014-0017]
Schickle, Karolina
Gerardo-Nava, Jose L. (Corresponding author)
Puidokas, Sabrina Michelle
Samadian Anavar, Sharareh
Bergmann, Christian
Gingter, Philipp
Schickle, Benjamin
Bobzin, Kirsten
Fischer, Horst
Corrosion of Wire Arc Sprayed ZnMgAl
In: Materials and corrosion = Werkstoffe und Korrosion, 66 (6), 520-526, 2015
[DOI: 10.1002/maco.201407601]
Bobzin, Kirsten
Öte, Mehmet
Linke, T. F.
Schulz, Christiane (Corresponding author)
Experimental and simulative strain field investigation of nano- and microscratches on nanolaminated (Cr, Al)N coating
In: Thin solid films, 573, 33-40, 2014
[DOI: 10.1016/j.tsf.2014.10.095]
Perne, Jan (Corresponding author)
Strukturen im Mikro-Format : Oberflächenstrukturen an PVD-Beschichteten Werkzeugeinsätze
In: Form + Werkzeug, Juni 2014, 65-65, 2014
Hopmann, Christian (Corresponding author)
Bobzin, Kirsten
Bagcivan, Nazlim
Brögelmann, Tobias
Schäfer, Christian
Schöngart, Maximilian
Development of (Cr,Al)ON coatings using middle frequency magnetron sputtering and investigations on tribological behavior against polymers
In: Surface and coatings technology, 260, 347-361, 2014
[DOI: 10.1016/j.surfcoat.2014.09.016]
Bagcivan, Nazlim
Bobzin, Kirsten
Brögelmann, Tobias (Corresponding author)
Kalscheuer, Christian
CrN/AlN nanolaminate coatings deposited via high power pulsed and middle frequency pulsed magnetron sputtering
In: Thin solid films, 572, 153-160, 2014
[DOI: 10.1016/j.tsf.2014.06.058]
Bagcivan, N.
Bobzin, Kirsten
Ludwig, A.
Grochla, D.
Brugnara, R. H. (Corresponding author)
Characterization of Reactive Air Brazed Ceramic/Metal Joints with Unadapted Thermal Expansion Behavior
In: Advanced engineering materials, 16 (12), 1490-1497, 2014
[DOI: 10.1002/adem.201400311]
Bobzin, Kirsten
Öte, Mehmet
Wiesner, Stefanie (Corresponding author)
Kaletsch, Anke
Broeckmann, Christoph
Influence of Filler and Base Material on the Pore Development during Reactive Air Brazing
In: Advanced engineering materials, 16 (12), 1456-1461, 2014
[DOI: 10.1002/adem.201400177]
Bobzin, Kirsten
Kopp, Nils
Wiesner, Stefanie (Corresponding author)
Tribological Evaluation of Hydrogenated DLC in Diesel Lubricated Diesel Model Test
In: Surface & coatings technology, 258, 381-391, 2014
[DOI: 10.1016/j.surfcoat.2014.08.065]
Djoufack, Martin (Corresponding author)
May, Ulrich
Bagcivan, Nazlim
Brögelmann, Tobias
Bobzin, Kirsten
Comparison of (Ti,Al)N and (Ti,Al)N/gamma-Al2O3 coatings regarding tribological behavior and machining performance
In: Surface & coatings technology, 257, 58-62, 2014
[DOI: 10.1016/j.surfcoat.2014.08.070]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, M.
Brugnara, R. H.
Bastürk, Serhan (Corresponding author)
High temperature corrosion behaviour of wire arc sprayed Fe based coatings
In: Surface engineering, 30 (8), 573-578, 2014
[DOI: 10.1179/1743294414Y.0000000287]
Li, R. (Corresponding author)
He, D. Y.
Zhou, Z.
Zhao, Lidong
Song, X. Y.
Microstructure behaviour and influence on thermally grown oxide formation of double-ceramic-layer EB-PVD thermal barrier coatings annealed at 1,300 °C under ambient isothermal conditions
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 45 (10), 879-893, 2014
[DOI: 10.1002/mawe.201400248]
Bobzin, Kirsten
Bagcivan, Nazlim
Brögelmann, Tobias
Yildirim, Baycan (Corresponding author)
Investigations of laser clad, thermal sprayed and laser remelted AlSi20-coatings on magnesium alloy AZ31B under constant and cycling thermal load
In: Surface & coatings technology, 259 (Pt. C), 751-758, 2014
[DOI: 10.1016/j.surfcoat.2014.09.049]
Rolink, Gesa (Corresponding author)
Weisheit, Andreas
Biermann, Tim
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Schulz, Christiane
Kelbassa, Ingomar
Einfluss der Wärmebehandlung auf Mikrostruktur und thermophysikalische Eigenschaften von Plasma gespritzten ZrO2-7%Y2O3- und La2Zr2O7-Schichten
In: Thermal spray bulletin, 7 (1), 43-49, 2014
Bobzin, Kirsten
Linke, Thomas Frederik
Zhao, Lidong
Erdogan, Garip
Üstel, Fatih
Öte, Mehmet
Emissions in Thermal Spraying : Development of a Suitable Test Method and Evaluation of Measurements in Laboratory as well as in Industrial Scale
In: Thermal spray bulletin, 7 (2), 136-141, 2014
Bobzin, Kirsten
Öte, Mehmet
Linke, Thomas Frederik
Dott, Wolfgang
Möller, Manfred
Erforschung Ti-Co-basierter, bioaktiver Auftraglötschichten auf oxidischen Hochleistungskeramiken in der Medizintechnik
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 45 (6), 504-511, 2014
[DOI: 10.1002/mawe.201400268]
Bobzin, Kirsten
Kopp, Nils
Wiesner, Stefanie
Puidokas, Sabrina Michelle
Samadian Anavar, Sharareh (Corresponding author)
Fischer, Horst
Korsten, Anne
Schickle, Karolina
Microstructure and high-temperature oxidation behavior of wire-arc sprayed Fe-based coatings
In: Surface & coatings technology, 251, 186-190, 2014
[DOI: 10.1016/j.surfcoat.2014.04.024]
Li, Ran (Corresponding author)
Zhou, Zheng
He, Dingyong
Zhao, Lidong
Song, Xiaoyan
Correlation between Chemical Glass Components and the Glass Sticking on Sputtered PtIr Physical Vapour Deposition Coatings for Precision Blank Moulding
In: Materials Sciences and Applications : MSA, 5, 316-329, 2014
[DOI: 10.4236/msa.2014.55037]
Bobzin, Kirsten
Bagcivan, Nazlim
Brögelmann, Tobias
Münstermann, Tobias
Plastic flow behavior of (Cr, Al) N hard coatings in dependence of strain rate and nanostructure
In: Thin solid films, 556, 390-394, 2014
[DOI: 10.1016/j.tsf.2014.01.069]
Perne, Jan (Corresponding author)
Influence of Ar/Kr ratio and pulse parameters in a Cr-N high power pulse magnetron sputtering process on plasma and coating properties
In: Journal of vacuum science & technology / A, Vacuum, surfaces, & films, 32 (2), 021513, 2014
[DOI: 10.1116/1.4865917]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Trieschmann, Jan
Brugnara, Ricardo H. (Corresponding author)
Preissing, Sven
Hecimovic, Ante
Wide Gap Active Brazing of Ceramic-to-Metal-Joints for High Temperature Applications
In: Frontiers of mechanical engineering in China, 9 (1), 71-74, 2014
[DOI: 10.1007/s11465-014-0291-0]
Bobzin, Kirsten
Zhao, Lidong (Corresponding author)
Kopp, Nils
Samadian Anavar, Sharareh
Systematische Untersuchung der Eigenschaften gelöteter Fügeverbunde mit anwendungsrelevanten Prüfverfahren
In: Schweißen und Schneiden, 65 (5), 254-261, 2013
Bobzin, Kirsten
Kopp, Nils
Puidokas, Sabrina Michelle
Tillmann, Wolfgang
Wojarski, Lukas
Liu, C.
Manka, Matthias
Einsatz von PVD-Beschichtungen zur Verschleißreduzierung im tribologischen System Pumpe
In: Tribologie und Schmierungstechnik, 61, 5-13, 2013
Bobzin, Kirsten (Corresponding author)
Bagcivan, Nazlim
Brögelmann, Tobias
Sauter, K.
Wegener, T.
Einfluss von Lot- und Grundwerkstoffen auf die Porosität mittels "Reactive Air Brazing" gelöteter Keramik-Keramik- und Keramik-Metall-Verbindungen
In: Schweissen und Schneiden, 65 (12), 838-842, 2013
Bobzin, Kirsten
Kopp, Nils
Wiesner, Stefanie
Wear and high-temperature corrosion behavior of a wire-arc sprayed NiCrB coating
In: Thermal spray bulletin, 2013 (1), 48, 2013
Zhou, Z.
Bobzin, Kirsten
He, D. Y.
Zhao, Lidong
Zhao, X. Z.
Kopp, Nils
Zhao, Q. Y.
Li, R. S.
Surface chemistry of PVD (Cr,Al)N coatings deposited by means of direct current and high power pulsed magnetron sputtering
In: Surface and interface analysis : Sia, 45 (13), 1884-1892, 2013
[DOI: 10.1002/sia.5336]
Kunze, Christian
Brugnara, Ricardo H.
Bagcivan, Nazlim
Bobzin, Kirsten
Grundmeier, Guido (Corresponding author)
Influence of temperature on phase stability and thermal conductivity of single- and double-ceramic-layer EB-PVD TBC top coats consisting of 7YSZ, Gd2Zr2O7 and La2Zr2O7
In: Surface & coatings technology, 237, 56-64, 2013
[DOI: 10.1016/j.surfcoat.2013.08.013]
Bobzin, Kirsten
Bagcivan, Nazlim
Brögelmann, Tobias
Yildirim, Baycan (Corresponding author)
Continuum and kinetic simulations of the neutral gas flow in an industrial physical vapor deposition reactor
In: Surface & coatings technology, 237, 176-181, 2013
[DOI: 10.1016/j.surfcoat.2013.08.018]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Brugnara, Ricardo H.
Schäfer, Marcel Pascal
Brinkmann, Ralf Peter
Mussenbrock, Thomas
Trieschmann, Jan (Corresponding author)
Influence of Application Technology on the Erosion Resistance of DLC coatings
In: Surface & coatings technology, 237, 284-291, 2013
[DOI: 10.1016/j.surfcoat.2013.07.043]
Depner-Miller, U. (Corresponding author)
Ellermeier, J.
Scheerer, H.
Oechsner, Matthias
Bobzin, Kirsten
Bagcivan, Nazlim
Brögelmann, Tobias
Weiss, R.
Durst, K.
Schmid, C.
Influence of HPPMS pulse length and inert gas mixture on the properties of (Cr,Al)N coatings
In: Thin solid films, 549, 192-198, 2013
[DOI: 10.1016/j.tsf.2013.06.036]
Bagcivan, Nazlim
Bobzin, Kirsten
Grundmeier, G.
Wiesing, M.
Ozcan, O.
Kunze, C.
Brugnara, Ricardo H. (Corresponding author)
Flow curve determination of thin films by improved finite element models and different nanoindenter geometries
In: Thin solid films, 549, 313-320, 2013
[DOI: 10.1016/j.tsf.2013.06.037]
Bobzin, Kirsten
Bagcivan, N.
Brugnara, R. H.
Perne, J. (Corresponding author)
Vereinfachte Berechnung der Mikrostruktur zur Ableitung der Schichteigenschaften im thermischen Spritzen
In: Jahrbuch Oberflächentechnik, 69, 139-154, 2013
Bobzin, Kirsten
Kopp, Nils
Linke, Thomas Frederik
Schäfer, Marcel Pascal
Investigation of the Properties of Low Temperature (Cr1-xAlx)N Coatings Deposited via Hybrid PVD DC-MSIP/HPPMS
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (8), 667-672, 2013
[DOI: 10.1002/mawe.201300173]
Bobzin, Kirsten
Bagcivan, Nazlim
Brugnara, Ricardo H. (Corresponding author)
Approach to determine stress strain curves by FEM supported nanoindentation
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (6), 571-576, 2013
[DOI: 10.1002/mawe.201300099]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Brugnara, Ricardo H.
Perne, Jan (Corresponding author)
Thermal stability of silicon-doped Al2O3 PVD coatings
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (8), 679-683, 2013
[DOI: 10.1002/mawe.201300175]
Bobzin, Kirsten
Bagcivan, Nazlim
Müller, M.
Ewering, Mara Therese
Brugnara, Ricardo H. (Corresponding author)
Development and qualification of a MSIP PVD iridium coating for precision glass moulding
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (8), 673-678, 2013
[DOI: 10.1002/mawe.201300174]
Bobzin, Kirsten
Bagcivan, Nazlim
Brögelmann, Tobias
Münstermann, Tobias (Corresponding author)
Improvement of Coating Properties in Three-Cathode Atmospheric Plasma Spraying
In: Journal of thermal spray technology : JTST, 22 (4), 502-508, 2013
[DOI: 10.1007/s11666-013-9902-2]
Bobzin, Kirsten
Kopp, Nils
Warda, Thomas
Petkovic, Ivica
Zimmermann, S. (Corresponding author)
Hartz-Behrend, K.
Landes, K.
Forster, G.
Kirner, S.
Marqués, J.-L.
Schein, J.
Prehm, J. (Corresponding author)
Möhwald, K.
Bach, Fr.-W.
Synthesis of nano-structured HPPMS CrN/AlN coatings
In: Journal of physics / D, Applied physics, 46 (8), 084001, 2013
[DOI: 10.1088/0022-3727/46/8/084001]
Bagcivan, Nazlim
Bobzin, Kirsten
Theiß, Sebastian
Flow curve determination on dc-MS and HPPMS CrAlN coatings
In: Journal of physics / D, Applied physics, 46 (8), 084006, 2013
[DOI: 10.1088/0022-3727/46/8/084006]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Perne, Jan (Corresponding author)
Particle In-Flight and Coating Properties of Fe-Based Feedstock Materials Sprayed with Modern Thermal Spray Systems
In: Journal of thermal spray technology : JTST, 22 (2/3), 363-370, 2013
[DOI: 10.1007/s11666-012-9853-z]
Bobzin, Kirsten
Kopp, Nils
Warda, Thomas (Corresponding author)
Petkovic, Ivica
Schaefer, Marcel
Landes, Klaus
Forster, Günter
Zimmermann, Stephan
Marques, Jose-Luis
Kirner, Stefan
Kauffeldt, Marina
Schein, Jochen
(Cr1-xAlx)N : A comparison of direct current, middle frequency pulsed and high power pulsed magnetron sputtering for injection molding components
In: Thin solid films, 528, 180-186, 2013
[DOI: 10.1016/j.tsf.2012.08.056]
Bagcivan, Nazlim
Bobzin, Kirsten
Theiß, Sebastian (Author)
Behavior of DLC coated low-alloy steel under tribological and corrosive load : Effect of top layer and interlayer variation
In: Surface & coatings technology, 215, 110-118, 2013
[DOI: 10.1016/j.surfcoat.2012.08.075]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Weiß, Raphael (Author)
Depner, Udo
Trossmann, Torsten
Ellermeier, Jörg
Oechsner, Matthias
Stellenwert des Plasmaspritzens unter den thermischen Spritzverfahren
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 103 (11), 2384-2395, 2012
Bobzin, Kirsten
Warda, Thomas
Brühl, Markus
Improving Contour Accuracy and Strength of Reactive Air Brazed (RAB) Ceramic/Metal Joints by Controlling Interface Microstructure
In: Advanced engineering materials, 14 (6), 394-399, 2012
[DOI: 10.1002/adem.201100274]
Li, Chichi
Kuhn, Bernd
Brandenberg, Jörg
Beck, Tilmann
Singheiser, Lorenz
Bobzin, Kirsten
Bagcivan, Nazlim
Kopp, Nils
Feasibility study of plasma sprayed Al2O3 coatings as diffusion barrier on CFC components
In: Frontiers of Mechanical Engineering, 7 (4), 371-375, 2012
[DOI: 10.1007/s11465-012-0339-y]
Bobzin, Kirsten
Zhao, Lidong
Kopp, Nils
Warda, Thomas
Thermisch gespritzte Korrosionsschutzschichten auf Zink-Basis als Ergänzung zum Stückverzinken von Bauteilen
In: Thermal spray bulletin, 5 (1), 48-55, 2012
Bobzin, Kirsten
Kopp, Nils
Warda, Thomas
Schulz, Christiane
Klesen, Christian
Poller, Benjamin
Ingendahl, Tobias
Determination of the Effective Properties of Thermal Spray Coatings Using 2D and 3D Models
In: Journal of thermal spray technology : JTST, 21 (6), 1269-1277, 2012
[DOI: 10.1007/s11666-012-9809-3]
Bobzin, Kirsten
Kopp, Nils
Warda, Thomas
Öte, Mehmet
Extrusion embossing of hydrophobic films - a study on process characteristics and surface properties
In: Zeitschrift Kunststofftechnik = Journal of plastics technology, 8 (3), 302-330, 2012
Hopmann, Christian
Michaeli, Walter
Eilbracht, Stephan
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Hartmann, Claudia
Holtkamp, Jens
Gillner, Arnold
Mayer, Joachim
Investigation of wear and corrosion protection of AlSi20 coatings produced by thermal spraying and laser cladding on AZ31B
In: Journal of thermal spray technology : JTST, 22 (2/3), 207-212, 2012
[DOI: 10.1007/s11666-012-9867-6]
Bobzin, Kirsten
Kopp, Nils
Warda, Thomas
Schulz, Christiane (Corresponding author)
Rolink, Gesa
Weisheit, Andreas
Comparison of (Cr0.75Al0.25)N Coatings Deposited by Conventional and High Power Pulsed Magnetron Sputtering
In: Contributions to plasma physics : CPP, 52 (7), 601-606, 2012
[DOI: 10.1002/ctpp.201210056]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Influence of interlayer thickness of a thin noble metal MSIP-PVD coating on compound and system properties for glass lens moulding
In: Production engineering, 6 (3), 311-318, 2012
[DOI: 10.1007/s11740-012-0385-7]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Brugnara, Ricardo H.
Münstermann, Tobias
Vanadium Alloyed PVD CrAlN Coatings for Friction Reduction in Metal Forming Applications
In: Tribology in Industry, 34 (2), 101-107, 2012
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Brugnara, Ricardo H.
Influence of the Layer Architecture of DLC Coatings on their Wear and Corrosion Resistance
In: International journal of materials research : IJMR, 103 (6), 774-782, 2012
[DOI: 10.3139/146.110763]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Weiß, Raphael
Troßmann, Torsten
Ellermeier, Jörg
Oechsner, Matthias
Depner, Udo
Kraftstoffersparnis durch Hochleistungswerkstoffe
In: Vakuum in Forschung und Praxis : VIP, 24 (2), 35-38, 2012
[DOI: 10.1002/vipr.201200487]
Bobzin, Kirsten
Bagcivan, Nazlim
Verpoort, Clemens
Schramm, Leander
Yilmaz, Koray
Theiß, Sebastian (Corresponding author)
Development of an integrative simulation method to predict the microstructural influence on the mechanical behaviour of semi-crystalline thermoplastic parts
In: International journal of materials research : IJMR, 103 (1), 120-130, 2012
[DOI: 10.3139/146.110628]
Michaeli, Walter
Hopmann, Christian
Bobzin, Kirsten
Arping, Tim Wilhelm
Baranowski, Thomas
Heesel, Barbara
Laschet, Gottfried
Schläfer, Thomas
Öte, Mehmet
Application of variothermal heating concepts for the production of micro-structured films using the extrusion embossing process
In: Journal of polymer engineering, 32 (2), 95-101, 2012
[DOI: 10.1515/polyeng-2012-0502]
Michaeli, Walter
Eilbracht, Stephan
Scharf, Micha Christian
Hartmann, Claudia
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Ultrasonic welding of hybrid metal-plastic components with flame spraying of adhesion layer
In: Zeitschrift Kunststofftechnik, 7, 161-177, 2011
Flock, Dustin (Corresponding author)
Haberstroh, Edmund
Bobzin, Kirsten
Schläfer, Thomas
Warda, Thomas
Kutschmann, Pia
Development of oxide based diffusion barrier coatings for CFC components applied in modern furnaces
In: Frontiers of Mechanical Engineering, 6 (4), 392-396, 2011
[DOI: 10.1007/s11465-011-0241-z]
Bobzin, Kirsten
Zhao, Lidong
Schläfer, Thomas
Warda, Thomas
HPPMS coatings for metal deformation tools
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 102 (5), 1150-1157, 2011
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Brugnara, Ricardo H.
Preparation and characterization of nanocrystalline ZrO2-7%Y2O3 powders for thermal barrier coatings by high-energy ball milling
In: Frontiers of Mechanical Engineering, 6 (2), 176-181, 2011
[DOI: 10.1007/s11465-011-0220-4]
Bobzin, Kirsten
Zhao, Lidong
Schläfer, Thomas
Warda, Thomas
Crystalline γ-Al2O3 Physical Vapour Deposition-Coating for Steel Thixoforging Tools
In: Journal of nanoscience and nanotechnology, 11 (10), 8782-8785, 2011
[DOI: 10.1166/jnn.2011.3469]
Bobzin, Kirsten
Hirt, Gerhard
Bagcivan, Nazlim
Khizhnyakova, Liudmila
Ewering, Mara Therese
Improving Long Term Oxidation Protection for Gamma-TiAl Substrates
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 42 (11), 1013-1018, 2011
[DOI: 10.1002/mawe.201100827]
Bobzin, Kirsten
Linke, Thomas Frederik
Brühl, Markus
Warda, Thomas
Schläfer, Thomas
Optimisation of an HVOF process using simulation techniques
In: Thermal spray bulletin, 2, 159-164, 2011
Bobzin, Kirsten
Schläfer, Thomas
Schäfer, Marcel Pascal
Wear behavior of HPPMS deposited (Ti,Al,Si)N coating under impact loading
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 42 (3), 165-171, 2011
[DOI: 10.1002/mawe.201100771]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Theiß, Sebastian
Hydrogen content variation for enhancing the lubricated tribological performance of DLC coatings with ester
In: Surface & coatings technology, 205 (Suppl. 2), 89-93, 2011
[DOI: 10.1016/j.surfcoat.2011.02.065]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Yilmaz, Koray
Die Entwicklung des Breitspaltaktivlötens als neue Fügetechnologie für Keramik-Metall-Mischverbunde mit Einsatztemperaturen oberhalb 500 °C
In: Keramische Zeitschrift, 63 (5), 329-333, 2011
Schlegel, Arne
Bobzin, Kirsten
Kopp, Nils
Bagcivan, Nazlim
Thermochemistry of brazing ceramics and metals in air
In: International journal of materials research : IJMR, 8 (08), 972-976, 2011
[DOI: 10.3139/146.110550]
Bobzin, Kirsten
Schläfer, Thomas
Kopp, Nils
Nachbearbeitungsarme Fe-Basis-Feinstpulverschichtenzum kostengünstigen Korrosionsund Verschleißschutz
In: Thermal spray bulletin, 4 (2), 139-146, 2011
Bobzin, Kirsten
Schläfer, Thomas
Warda, Thomas
Schäfer, Marcel Pascal
Injection molding of products with functional surfaces by micro-structured, PVD coated injection molds
In: Production engineering, 5 (4), 415-422, 2011
[DOI: 10.1007/s11740-011-0319-9]
Bobzin, Kirsten
Bagcivan, Nazlim
Gillner, Arnold
Hartmann, Claudia
Holtkamp, Jens
Michaeli, Walter
Klaiber, Fritz
Schöngart, Maximilian
Theiß, Sebastian
PVD-beschichteteWälzlager im Trockenlauf
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 42 (11), 1025-1034, 2011
[DOI: 10.1002/mawe.201100847]
Jacobs, Georg
Rombach, Volker
Plogmann, Michael
van Lier, Hermann
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Weiß, Raphael (Corresponding author)
In-Vitro Study of Microplasma Sprayed Hydroxyapatite Coatings in Hanks Balanced Salt Solution
In: Materials and manufacturing processes, 26 (2), 175-180, 2011
[DOI: 10.1080/10426914.2010.498071]
Zhao, Qiuying
He, Dingyong
Zhao, Lidong
Li, Xiaoyan
Replication of specifially microstructured surfaces in A356-alloy via lost wax investment casting
In: Journal of micromechanics and microengineering, 21 (8), 085026, 2011
[DOI: 10.1088/0960-1317/21/8/085026]
Ivanov, Todor
Bührig-Polaczek, Andreas
Vroomen, Uwe
Hartmann, Claudia
Holtkamp, Jens
Gillner, Arnold
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Numerical and experimental determination of plasma temperature during air plasma spraying with a multiple cathodes torch
In: Journal of materials processing technology, 211 (10), 1620-1628, 2011
[DOI: 10.1016/j.jmatprotec.2011.05.001]
Bobzin, Kirsten
Bagcivan, Nazlim
Petkovic, Ivica
Modelling and diagnostics of multiple cathodes plasma torch system for plasma spraying
In: Frontiers of Mechanical Engineering, 6 (3), 324-331, 2011
[DOI: 10.1007/s11465-011-0125-2]
Bobzin, Kirsten
Bagcivan, Nazlim
Zhao, Lidong
Petkovic, Ivica
Schein, Jochen
Hartz-Behrend, Karsten
Kirner, Stefan
Marqués, José-Luis
Forster, Günter
DC-MSIP/HPPMS (Cr,Al,V)N and (Cr,Al,W)N thin films for high-temperature friction reduction
In: Surface & coatings technology, 205 (8/9), 2887-2892, 2011
[DOI: 10.1016/j.surfcoat.2010.10.056]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Brugnara, Ricardo H.
Theiß, Sebastian
A Strong Connection of Unequal Partners [Joining method ]
In: Kunststoffe / Kunststoffe international, 100 (11), 50-53, 2010
Flock, Dustin
Haberstroh, Edmund
Rosner, A.
Gillner, Arnold
Poprawe, N. R.
Theiß, Sebastian
Bagcivan, Nazlim
Bobzin, Kirsten
Wagner, Nikolaus
Olschok, Simon
Reisgen, Uwe
Characterisation of plasma-sprayed SrFe12O19 coatings for electromagnetic wave absorption
In: Journal of the European Ceramic Society, 31 (8), 1439-1449, 2010
[DOI: 10.1016/j.jeurceramsoc.2011.02.003]
Bobzin, Kirsten
Bolelli, Giovanni
Brühl, Markus
Hujanen, Arto
Lintunen, Pertti
Lisjak, Darja
Gyergyek, Sašo
Lusvarghi, Luca
Entwicklung von neuen Aktivlotpulvern auf Basis kommerzieller Nickellote mit Zirkon als Aktivelement zum Fügen von Keramik-Metall-Verbunden
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 41 (6), 455-463, 2010
[DOI: 10.1002/mawe.201000627]
Bobzin, Kirsten
Schläfer, Thomas
Kopp, Nils
Schlegel, Arne
Deposition of High-Quality NiCoCrAlTaReSiY Oxidation Resistance Coatings by HVOF
In: Xiyou-jinshu-cailiao-yu-gongcheng = Rare metal materials and engineering, 39 (11), 2027-2029, 2010
Wang, Kaisheng
Zhao, Lidong
Zhao, Zhimin
Systematische Untersuchung der Verbindungseigenschaften von Lötungen mit Ag-, Cu-, Au- und Ni-Basisloten mit anwendungsrelevanten Prüfverfahren
In: Schweissen und Schneiden, 62 (5), 256-263, 2010
Bobzin, Kirsten
Schläfer, Thomas
Kopp, Nils
Puidokas, Sabrina Michelle
Tillmann, Walter
Osmanda, Artur Martin
Wojarski, Lukas
Untersuchung und Bewertung der Fehlergrößen im Haftzugversuch nach DIN EN 582
In: Thermal spray bulletin, 3 (1), 30-36, 2010
Bobzin, Kirsten
Schläfer, Thomas
Aumund-Kopp, Claus
Calculation of effective properties of textile reinforced aluminum alloy by a two-step homogenization procedure
In: Computational materials science, 47 (3), 801-806, 2010
[DOI: 10.1016/j.commatsci.2009.11.007]
Bobzin, Kirsten
Bagcivan, Nazlim
Parkot, Daniel
Kashko, Tatyana
Hexaferrite/Polyester Composite Coatings for Electromagnetic-Wave Absorbers
In: Journal of thermal spray technology : JTST, 20 (3), 638-644, 2010
[DOI: 10.1007/s11666-010-9607-8]
Lisjak, Darja
Bégard, Marion
Brühl, Markus
Bobzin, Kirsten
Hujanen, Arto
Lintunen, Pertti
Bolelli, Giovanni
Lusvarghi, Luca
Ovtar, Simona
Drofenik, Miha
HPPMS-Beschichtung für Umformwerkzeuge
In: Jahrbuch Oberflächentechnik, 66, 88-95, 2010
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Brugnara, Ricardo H.
Impact Behaviour of PtIr-based Coatings with Different Interlayers for Glass Lens Moulding
In: Key engineering materials, 438, 57-64, 2010
[DOI: 10.4028/www.scientific.net/KEM.438.57]
Bobzin, Kirsten
Klocke, Fritz
Bagcivan, Nazlim
Ewering, Mara Therese
Georgiadis, Kyriakos
Münstermann, Tobias
Thermal stability of [gamma]-Al2O3 coatings for challenging cutting operations
In: Surface & coatings technology, 205 (5), 1444-1448, 2010
[DOI: 10.1016/j.surfcoat.2010.07.040]
Bobzin, Kirsten
Bagcivan, Nazlim
Reinholdt, Alexander
Ewering, Mara Therese
Plasma coatings CrAlN and a-C:H for high efficient power train in automobile
In: Surface & coatings technology, 205 (5), 1502-1507, 2010
[DOI: 10.1016/j.surfcoat.2010.08.108]
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Yilmaz, Koray
Hartstoffschichten der Zukunft : Oxidische Schichten und HPPMS-Schichten für anspruchsvolle Zerspanaufgaben
In: Vakuum in Forschung und Praxis : VIP, 22 (6), 31-35, 2010
[DOI: 10.1002/vipr.201000437]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Metal flow and die wear in semi-solid forging of steel using coated dies
In: Transactions of Nonferrous Metals Society of China : english edition, 20 (Supplement 3), 954-960, 2010
[DOI: 10.1016/s1003-6326(10)60613-9]
Khizhnyakova, L.
Ewering, Mara Therese
Hirt, Gerhard
Bobzin, Kirsten
Bagcivan, Nazlim
Influence of the filler materials on flux-free brazing of pure aluminium (1050)
In: Frontiers of mechanical engineering in China, 5 (1), 47-51, 2010
[DOI: 10.1007/s11465-009-0079-9]
Bobzin, Kirsten
Zhao, Lidong
Schläfer, Thomas
Warda, Thomas
Application of cold spraying for flux-free brazing of aluminium alloy 6060
In: Frontiers of mechanical engineering in China, 5 (3), 256-260, 2010
[DOI: 10.1007/s11465-010-0095-9]
Bobzin, Kirsten
Zhao, Lidong
Schläfer, Thomas
Warda, Thomas
Semi-solid forming of non axis-symmetric parts from steel grade X210CrW12 with PVD coated tools
In: International journal of material forming, 3 (1), 731-734, 2010
[DOI: 10.1007/s12289-010-0874-1]
Hirt, Gerhard
Bobzin, Kirsten
Khizhnyakova, Liudmila
Ewering, Mara Therese
Bagcivan, Nazlim
Development of Ba-hexaferrite coatings for electromagnetic wave absorption applications
In: Surface & coatings technology, 205 (4), 1015-1020, 2010
[DOI: 10.1016/j.surfcoat.2010.03.060]
Bobzin, Kirsten
Schläfer, Thomas
Bégard, Marion
Brühl, Markus
Bolelli, Giovanni
Lusvarghi, Luca
Lisjak, Darja
Hujanen, Arto
Lintunen, Pertti
Kanerva, Ulla
Varis, Tommi
Pasquale, Massimo
Magnetic Phase Formation in CoTi-Substituted Ba Hexaferrite Coatings Prepared with Atmospheric Plasma Spraying
In: Journal of the American Ceramic Society, 93 (9), 2579-2584, 2010
[DOI: 10.1111/j.1551-2916.2010.03770.x]
Lisjak, Darja
Bolelli, Giovanni
Lusvarghi, Luca
Bégard, Marion
Brühl, Markus
Bobzin, Kirsten
Lintunen, Pertti
Kanerva, Ulla
Pasquale, Massimo
Drofenik, Miha
Starke Verbindung ungleicher Partner
In: Kunststoffe / [Deutsche Ausgabe], 11 (112), 60-63, 2010
Flock, Dustin
Haberstroh, Edmund
Rösner, Andreas
Gillner, Arnold
Poprawe, Reinhart
Theiß, Sebastian
Bagcivan, Nazlim
Bobzin, Kirsten
Wagner, Nikolaus
Olschok, Simon
Reisgen, Uwe
Development of PVD coatings for application of zinc die casting
In: International foundry research, 62 (10), 8-14, 2010
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Development of new transient liquid phase system Au-Sn-Au for microsystem technology
In: Frontiers of mechanical engineering in China, 5 (4), 370-375, 2010
[DOI: 10.1007/s11465-010-0107-9]
Bobzin, Kirsten
Bagcivan, Nazlim
Zhao, Lidong
Ferrara, Stefania
Perne, Jan
Brazing of ceramic-to-ceramic and ceramic-to-metal joints in air
In: Frontiers of mechanical engineering in China, 5 (2), 125-129, 2010
[DOI: 10.1007/s11465-010-0007-z]
Bobzin, Kirsten
Schläfer, Thomas
Zhao, Lidong
Kopp, Nils
Schlegel, Arne
Lotus-Effekt für Massenprodukte : Mikrostrukturierte Kunststoffbauteile durch Abformen eines Werkzeuges herstellen
In: Der Plastverarbeiter : PV, 2010 (9), 104-106, 2010
Bagcivan, Nazlim
Bobzin, Kirsten
Eilbracht, Stephan
Gillner, Arnold
Hartmann, Claudia
Klaiber, Fritz
Michaeli, Walter
Scharf, Micha Christian
Theiß, Sebastian
Environmentally friendly tribological systems in axial piston machines
In: Tribologie und Schmierungstechnik, 57 (3), 27-31, 2010
Murrenhoff, Hubertus
Enekes, Claus Peter
Gold, Peter Werner
Jacobs, Georg
Rombach, Volker
Plogmann, Michael
Bobzin, Kirsten
Bagcivan, Nazlim
Theiß, Sebastian
Göbbels, Nico
Influence of different pulse parameters on the deposition of Al2O3
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 41 (8), 670-674, 2010
[DOI: 10.1002/mawe.201000653]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Hot Forging of C45 using PVD (Ti,Al)N/γ-Al2O3 Coated Dies
In: Steel research international, 81 (7), 603-609, 2010
[DOI: 10.1002/srin.201000031]
Bobzin, Kirsten
Hirt, Gerhard
Springorum, F.
Zitz, U.
Steinhof, N.
Bagcivan, Nazlim
Baadjou, René
Ewering, Mara Therese
Immich, Philipp
Development of NiZn-Ferrite Coatings for Electromagnetic Applications
In: Welding and cutting, 9 (2), 111-116, 2010
Talaka, Tatiana
Ilyuschencko, Alexander
Weil, Carsten
Linden, Ismo
McCartney, Graham
Zhang, Deen
Yellup, John Y.
Brühl, Markus
Bobzin, Kirsten
Understanding HPPMS PVD
In: Europhysics news, 41 (3), 14-15, 2010
Theiß, Sebastian
Bibinov, N.
Bagcivan, Nazlim
Ewering, Mara Therese
Awakowicz, Peter
Bobzin, Kirsten
Time resolved optical emission spectroscopy of an HPPMS coating process
In: Journal of physics / D, Applied physics, 43 (7), 8-8, 2010
[DOI: 10.1088/0022-3727/43/7/075205]
Theiß, Sebastian
Bibinov, Nikita
Bagcivan, Nazlim
Ewering, Mara Therese
Awakowicz, Peter
Bobzin, Kirsten
Microstructure and complex magnetic permeability of thermally sprayed NiZn ferrite coatings for electromagnetic wave absorbers
In: Surface engineering, 26 (6), 484-490, 2010
[DOI: 10.1179/026708410X12687356948634]
Brühl, Markus
Zhang, Deen
Talaka, Tatiana
Weil, Carsten
Linden, Ismo
Bobzin, Kirsten
Ilyuschencko, Alexander
McCartney, Graham
Yellup, John Y.
Crystalline γ-Alumina Deposited in an Industrial Coating Unit for Demanding Turning Operations
In: Advanced engineering materials, 12 (1/2), 75-79, 2010
[DOI: 10.1002/adem.200900232]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Modeling of Coating Process, Phase Changes, and Damage of Plasma Sprayed Thermal Barrier Coatings on Ni-Base Superalloys
In: Advanced engineering materials, 12 (3), 110-126, 2009
[DOI: 10.1002/adem.201000023]
Beck, Tilmann
Bialas, Marcin
Bednarz, Piotr
Singheiser, Lorenz
Bobzin, Kirsten
Bagcivan, Nazlim
Parkot, Daniel
Kashko, Tatyana
Petkovic, Jvica
Hallstedt, Bengt
Nemna, Sergey
Schneider, Jochen M.
Simulation of PYSZ particle impact and solidification in atmospheric plasma spraying coating process
In: Surface & coatings technology, 204 (8), 1211-1215, 2010
[DOI: 10.1016/j.surfcoat.2009.10.028]
Bobzin, Kirsten
Bagcivan, Nazlim
Parkot, Daniel
Petkovic, Ivica
Microstructure and properties of HVOF sprayed AP40 bioactive glass-ceramic coatings
In: Beijing-Gongye-Daxue-xuebao : jikan = Journal of Beijing University of Technology, 35 (3), 374-377, 2009
Ding-Yong, He
Li-Dong, Zhao
Modified plastic surfaces for growth of adherent cells, localized genetic modification and cell selection
In: Human gene therapy, 20 (11), 1436-1436, 2009
Meyring, Wilhelm
Schoen, Oliver
Zghoul, Nadia
Pohl, Susanne
Dohse, Antje
Thomas, Michael
Garritsen, Henk
Woermann, Bernhard
Dittmar, Kurt
Lindenmaier, Werner
Impact behavior of (Ti,Al,Si)N deposited by HPPMS
In: Thin solid films, 518 (5), H2-2-7, 2009
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Theiß, Sebastian
Bolz, Stephan Frédéric
Crystalline y-Al2O3 Coating for Steel Thixoforging Tools
In: Journal of nanoscience and nanotechnology, 9 (Special issue), 2009
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Khizhnyakova, Luidmila
Challenging gold based filler metals for uses in medicine
In: Materials science and technology : MST, 25 (12), 1422-1431, 2009
[DOI: 10.1179/174328407X226590]
Bobzin, Kirsten
Lugscheider, Erich
Ernst, F.
Rösing, J.
Ferrara, S.
Entwicklung von Diffusionssperrschichten für CFC-Bauteile mittels thermischer Spritztechnik
In: Thermal spray bulletin, 2 (1), 34-38, 2009
Bobzin, Kirsten
Zhao, Lidong
Schläfer, Thomas
Warda, Thomas
Influence of the definition of the representative volume element on the effective thermoelastic properties of thermal barrier coatings with random microstructure
In: Journal of thermal spray technology : JTST, 18 (5/6), 988-995, 2009
[DOI: 10.1007/s11666-009-9351-0]
Bobzin, Kirsten
Bagcivan, Nazlim
Parkot, Daniel
Kashko, Tatyana
Laschet, Gottfried
Scheele, Josef
Surface-brazed wear protection systems for titanium alloys
In: Welding and cutting, 8 (4), 211-213, 2009
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Schlegel, Arne
Kopp, Nils
Skalenübergreifende Simulation teilkristalliner Thermoplaste
In: Werkstoffe in der Fertigung : die Fachzeitschrift für technische Führungskräfte, 2009 (5), 33-34, 2009
Michaeli, Walter
Baranowski, Thomas
Heesel, Barbara
Bobzin, Kirsten
Kashko, Tatyana
Parkot, Daniel
Bagcivan, Nazlim
Effect of the Substrate Geometry on Plasma Synthesis of DLC Coatings
In: Plasma processes and polymers, 6.2009 (6/7), 425-S428, 2009
[DOI: 10.1002/ppap.200931010]
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
Yilmaz, Koray
Effect of heat treatment on the microstructure and mechanical properties of Fe-based amorphous coatings
In: Journal of alloys and compounds : JAL, 480 (2), 422-427, 2009
[DOI: 10.1016/j.jallcom.2009.02.107]
Fu, Bin-you
He, Ding-yong
Zhao, Lidong
Microstructure characterisation and wear properties of arc sprayed NiB containing amorphous coatings
In: Surface engineering, 25 (4), 326-332, 2009
[DOI: 10.1179/026708409X364966]
Fu, Bin-you
He, Ding-Yong
Zhao, Lidong
Li, X. Y.
Microstructure and properties of arc sprayed coatings containing Fe based amorphous phase and nanocrystallites
In: Surface engineering, 25 (4), 333-337, 2009
[DOI: 10.1179/026708409X396060]
Fu, Bin-You
He, Ding-Yong
Zhao, Lidong
Jiang, J. M.
Li, X.Y.
Arc Ion Plating Process Monitoring by Optical Emission Spectroscopy Exemplified for Chromium Containing Coatings
In: Plasma processes and polymers, 6.2009 (6/7), S357-S361, 2009
[DOI: 10.1002/ppap.200930806]
Bobzin, Kirsten
Bagcivan, Kirsten
Immich, Philipp
Theiß, Sebastian
Investigation of Properties and Wear Behavior of HVOF Sprayed TiC-Strengthened Fe Coatings
In: Journal of thermal spray technology : JTST, 18 (4), 672-677, 2009
[DOI: 10.1007/s11666-009-9384-4]
Bobzin, Kirsten
Schläfer, Thomas
Richardt, Katharina Rebecca Maria
Warda, Thomas
Reisel, Guido
Modeling and Simulation of Microstructure Formation for Porosity Prediction in Thermal Barrier Coatings Under Air Plasma Spraying Condition
In: Journal of thermal spray technology : JTST, 18 (5), 975-980, 2009
[DOI: 10.1007/s11666-009-9340-3]
Bobzin, Kirsten
Bagcivan, Nazlim
Parkot, Daniel
Schäfer, Marcel Pascal
Petkovic, Ivica
Lubricated PVD CrAlN and WC/C coatings for automotive applications
In: Surface & coatings technology, 204 (6/7), 1097-1101, 2009
[DOI: 10.1016/j.surfcoat.2009.07.045]
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
Yilmaz, Koray
Höhn, Bernd-Robert
Michaelis, Klaus
Hochmann, Michael
Development of NiZn-ferrite coatings for electromagnetic applications
In: Thermal spray bulletin, 2 (2), 126-132, 2009
Talaka, Tatiana
Ilyuschencko, Alexander
Weil, Carsten
Linden, Ismo
McCartney, Graham
Zhang, Deen
Yellup, John Y.
Brühl, Markus
Bobzin, Kirsten
Detektion von Verunreinigungen beim bleifreien Wellen- und Selektivlöten und deren Auswirkungen auf die Lötstelle
In: Schweissen und Schneiden, 61 (7), 358-368, 2009
Bach, Friedrich-Wilhelm
Möhwald, Kai
Schaup, Jörg
Holländer, Ulrich
Herzog, Thomas
Wohlrabe, Heinz
Wielage, Bernhard
Lampke, Thomas
Weber-Nester, Daisy
Bobzin, Kirsten
PVD Beschichtung von Polyetheretherketon (PEEK) zur Verschleiß- und Reibungsminimierung im Kontakt Käfig-Führungsbord eines Spindellagers
In: Tribologie und Schmierungstechnik, 56, 11-15, 2009
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
Properties of (Ti,Al,Si)N coatings for high demanding metal cutting applications deposited by HPPMS in an industrial coating unit
In: Plasma processes and polymers, 6.2009 (6/7), S124-128, 2009
[DOI: 10.1002/ppap.200930408]
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Bolz, Stephan Frédéric
Fuß, Hans-Gerd
Cremer, Rainer
Preparation of barium hexaferrite coatings using atmospheric plasma spraying
In: Journal of the European Ceramic Society, 29 (11), 2333-2341, 2009
[DOI: 10.1016/j.jeurceramsoc.2009.01.028]
Lisjak, Darja
Bobzin, Kirsten
Richardt, Katharina Rebecca Maria
Bégard, Marion
Bolelli, Giovanni
Lusvarghi, Luca
Hujanen, Arto
Lintunen, Pertti
Pasquale, Massimo
Olivetti, Elena
Drofenik, Miha
Schläfer, Thomas
Wiederaufarbeitung von Motorzylinderbohrungen durch Spritzreparatur unter Anwendung des PTWA-Verfahrens (Plasma Transferred Wire Arc)
In: Thermal spray bulletin, 2 (1), 26-31, 2009
Bobzin, Kirsten
Schläfer, Thomas
Beardsley, Brad
Gerke, Dan
Sharp, Bob
Blume, Fritz
Silk, Mark
Schramm, Leander
Schwenk, Alexander
Lindon, Spencer
Entwicklung von eisenbasierten Spritzzusatzwerkstoffen und deren Verarbeitung durch Lichtbogenspritzen
In: Thermal spray bulletin, 2 (1), 58-63, 2009
Bobzin, Kirsten
Zhao, Lidong
Schläfer, Thomas
Kutschmann, Pia
Eigenschaftsoptimierung eines niedriglegierten Stahls mittels PVD- (Physical Vapour Deposition) Technologie
In: Jahrbuch Oberflächentechnik, 65, 103-108, 2009
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
Weiß, Raphael
Investigations on nanolaminated TiZrN/CrN as a tribological PVD hard coating for incremental sheet forming tools
In: Advanced engineering materials, 11 (8), 674-679, 2009
[DOI: 10.1002/adem.200900088]
Bobzin, Kirsten
Bagcivan, Nazlim
Ewering, Mara Therese
Warnke, Carsten
Thermal investigation of Al2O3 thin films for application in cutting operations
In: Advanced engineering materials, 11 (7), 590-594, 2009
[DOI: 10.1002/adem.200800421]
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Ewering, Mara Therese
High power pulsed magnetron sputtering: fundamentals and applications
In: Journal of alloys and compounds : JAL, 483.2009 (1/2), 530-534, 2009
[DOI: 10.1016/j.jallcom.2008.08.104]
Alami, Jones
Bolz, Stephan Frédéric
Sarakinos, Kostas
Thermal spraying of Co,Ti-substituted Ba-hexaferrite coatings for electromagnetic wave absorption applications
In: Surface & coatings technology, 203 (20/21), 3312-3319, 2009
[DOI: 10.1016/j.surfcoat.2009.04.007]
Bégard, Marion
Bobzin, Kirsten
Bolelli, Giovanni
Hujanen, Arto
Lintunen, Pertti
Lisjak, Darja
Gyergyek, Sašo
Lusvarghi, Luca
Pasquale, Massimo
Richardt, Katharina Rebecca Maria
Schläfer, Thomas
Varis, Tommi
Hybridprozessentwicklung zur Plasmasynthese temperaturbeständiger Kohlenstoffschichten
In: WING, 2009, 2009
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Yilmaz, Koray
Advancement of a nanolaminated TiHfN/CrN PVD tool coating by a nano-structured CrN top layer in interaction with a biodegradable lubricant for green metal forming
In: Surface & coatings technology, 203 (20/21), 3184-3188, 2009
[DOI: 10.1016/j.surfcoat.2009.03.053]
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Warnke, Carsten
Klocke, Fritz
Zeppenfeld, Christoph
Mattfeld, Patrick
Advantages of nanocomposite coatings deposited by high power pulse magnetron sputtering technology
In: Journal of materials processing technology, 209 (1), 165-170, 2009
[DOI: 10.1016/j.jmatprotec.2008.01.035]
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Bolz, Stephan Frédéric
Alami, Jones
Cremer, Rainer
Development of a new wear resistant coating by arc spraying of a steel-based cored wire
In: Frontiers of mechanical engineering in China, 4 (1), 7-10, 2008
[DOI: 10.1007/s11465-009-0012-2]
Zhao, Lidong
Binyou Fu
Dingyong He
Kutschmann, Pia
Untersuchung zum flussmittelfreien Löten einer AlMg3-Legierung mit Hilfe der Kaltgasbelotung
In: Thermal spray bulletin, 1 (1), 50-54, 2008
Bobzin, Kirsten
Lugscheider, Erich
Ernst, Felix Björn Gustav
Richardt, Katharina Rebecca Maria
Zhao, Lidong
Neue HPPMS-Technologie - Zerspanwerkzeuge hochpulsig beschichten
In: Journal für Oberflächentechnik : JOT, 48 (1), 34-35, 2008
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Bolz, Stephan Frédéric
HyDraNo
In: WING : das Jahrbuch, 2007, 2008
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
NaCoLab
In: WING : das Jahrbuch, 2007, 2008
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Schläfer, Thomas
Richardt, Katharina Rebecca Maria
Hybridprozessentwicklung zur Plasmasynthese temperaturbeständiger Kohlenstoffschichten
In: WING, 2008, 2008
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Yilmaz, Koray
PVD - Eine Erfolgsgeschichte mit Zukunft
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 39 (1), 5-12, 2008
[DOI: 10.1002/mawe.200700252]
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Pinero, Carmen
Göbbels, Nico
Krämer, Anika
Zukunftsweisende Werkstoffkombinationen und Beschichtung beliebiger Konturen möglich
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 100 (1), 192-193, 2008
Bobzin, Kirsten
Thermisch gespritzte titankarbidverstärkte Eisenbasisschichten als Alternative zu konventionellen karbidischen Werkstoffen
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 39 (1), 13-17, 2008
[DOI: 10.1002/mawe.200700235]
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Richardt, Katharina Rebecca Maria
Warda, Thomas
Reisel, Guido
A look at the development of magnesium-based filler metals
In: Welding journal, 87 (3), 38-40, 2008
Bobzin, Kirsten
Lugscheider, Erich
Ernst, Felix Björn Gustav
Schlegel, Arne
Rösing, Jürgen
Jäger, Doris
Developing PVD zirconium-oxide coatings for use of thixoforming of steel
In: International journal of microstructure and materials properties : IJMMP, 3 (2/3), 267-270, 2008
[DOI: 10.1504/IJMMP.2008.018733]
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Immich, Philipp
Mikrostruktur und Eigenschaften lichtbogengespritzter Schichten auf Eisenbasis
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 39 (12), 867-870, 2008
[DOI: 10.1002/mawe.200800393]
Bobzin, Kirsten
Schläfer, Thomas
Richardt, Katharina Rebecca Maria
Zhao, Lidong
Kutschmann, Pia
Coating bores of light metal engine blocks with a nanocomposite material using the plasma transferred wire arc thermal spray process
In: Journal of thermal spray technology : JTST, 17 (3), 344-351, 2008
[DOI: 10.1007/s11666-008-9188-y]
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Zwick, Jochen Bernt
Schläfer, Thomas
Cook, David
Nassenstein, Klaus
Schwenk, Alexander
Schreiber, Frank
Wenz, Thomas
Flores, Gerhard
Hahn, Mareike
Solders development and application process for a micro chip-camera
In: Microsystem technologies, 14.2008 (12), 1887-1894, 2008
[DOI: 10.1007/s00542-008-0613-4]
Bobzin, Kirsten
Lugscheider, Erich
Ernst, Felix Björn Gustav
Nickel, Reimo
Bagcivan, Nazlim
Parkot, Daniel
Schlegel, Arne
Ferrara, Stefania
Kashko, Tatyana
Leick, Noémi
Untersuchung des Benetzungsverhaltens von Schmierstoffen auf PVD-beschichteten Oberflächen und dessen Einfluss auf tribologische Eigenschaften
In: Tribologie und Schmierungstechnik, 55 (1), 5-9, 2008
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Yilmaz, Koray
Untersuchung des Einflusses unterschiedlicher Karbidbildner auf das tribologische Verhalten mittels reaktivem Magnetron-Sputter-Ion-Plating MSIP abgeschiedener Nanocomposite nc-MeC/a-C:H Beschichtungen
In: Tribologie und Schmierungstechnik, 55 (2), 5-10, 2008
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Göbbels, Nico
Anwendungen von Modellierung und Simulation zur Vorhersage der Spritzpartikel-Morphologie unter APS-Prozessbedingungen
In: Thermal spray bulletin, 1 (2), 114-118, 2008
Bobzin, Kirsten
Bagcivan, Nazlim
Parkot, Daniel
Petkovic, Ivica
Thermal spraying of cylinder bores with the plasma transferred wire arc process
In: Surface & coatings technology, 202 (18), 4438-4443, 2008
[DOI: 10.1016/j.surfcoat.2008.04.023]
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Richardt, Katharina Rebecca Maria
Schläfer, Thomas
Verpoort, Clemens
Flores, Gerhard
Qualitätssicherung durch On-Line Prozessdiagnostik
In: Schweissen und Schneiden, 60 (2), 84-87, 2008
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Zwick, Jochen Bernt
Richardt, Katharina Rebecca Maria
Landes, Klaus
Zierhut, Jochen
Vorteile superharter Nanocomposite Beschichtungen für Zerspanwerkzeuge, abgeschieden mittels High Power Pulse Magnetron Sputtering
In: Jahrbuch Oberflächentechnik, 64, 81-88, 2008
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Bolz, Stephan Frédéric
Hydrano - Leistungssteigerung hydraulischer Verdrängereinheiten durch Nanocomposites
In: WING, 2008, 2008
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
Flux-free brazing of Mg-containing aluminium alloys by means of cold spraying
In: Frontiers of mechanical engineering in China, 3 (4), 355-359, 2008
[DOI: 10.1007/s11465-008-0055-9]
Bobzin, Kirsten
Zhao, Lidong
Ernst, Felix Björn Gustav
Richardt, Katharina Rebecca Maria
Die Oberfläche macht den Unterschied : der systemische Lösungsansatz in der industriellen Plasma-Oberflächentechnik
In: Intelligenter produzieren, 2008 (4), 10-12, 2008
Bobzin, Kirsten
Bagcivan, Nazlim
Development of oxide dispersion strengthened MCrAlY coatings
In: Journal of thermal spray technology : JTST, 17 (5/6), 853-857, 2008
[DOI: 10.1007/s11666-008-9244-7]
Bobzin, Kirsten
Schläfer, Thomas
Richardt, Katharina Rebecca Maria
Brühl, Markus
Verschleißschutz durch thermisches Spritzen : Stand und Perspektiven
In: Stahl, 2008 (3), 28-30, 2008
Bobzin, Kirsten
Schläfer, Thomas
Richardt, Katharina Rebecca Maria
Kutschmann, Pia
Tailor-made coatings for turbine applications using the Triplex Pro 200
In: Journal of thermal spray technology : JTST, 17 (5/6), 612-616, 2008
[DOI: 10.1007/s11666-008-9236-7]
Richardt, Katharina Rebecca Maria
Bobzin, Kirsten
Sporer, Dieter
Schläfer, Thomas
Fiala, Petr
Mechanical properties and oxidation behaviour of (Al,Cr)N and (Al,Cr,Si)N coatings for cutting tools deposited by HPPMS
In: Thin solid films, 517 (3), 1251-1256, 2008
[DOI: 10.1016/j.tsf.2008.06.050]
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Bolz, Stephan Frédéric
Cremer, Rainer
Leyendecker, Thorsten
An extremely successful ITSC 2008
In: Thermal spray bulletin, 1 (2), 90-92, 2008
Bobzin, Kirsten
Schläfer, Thomas
Richardt, Katharina Rebecca Maria
Brühl, Markus
Titankarbidverstärkte Eisenbasiswerkstoffe : eine kostengünstige Lösung für Verschleißschutzanwendungen
In: Thermal spray bulletin, 1 (2), 120-126, 2008
Bobzin, Kirsten
Schläfer, Thomas
Richardt, Katharina Rebecca Maria
Warda, Thomas
Reisel, Guido
Deposition of oxides as tool protection for large thixoforming dies by using the pulsed MSIP-PVD process
In: Diffusion and defect data - solid state data : Pt. B. Solid state phenomena, 141/143, 249-254, 2008
[DOI: 10.4028/3-908451-59-0.249]
Bobzin, Kirsten
Bagcivan, Nazlim
Immich, Philipp
Der Exzellenzcluster Integrative Produktionstechnik für Hochlohnländer der RWTH Aachen University : Herstellung hybrider Metall-Kunststoffbauteile durch moderne Fügeverfahren
In: Joining plastics = Fügen von Kunststoffen, 2 (3), 210-216, 2008
Bobzin, Kirsten
Theiß, Sebastian
Poprawe, Reinhart
Rösner, Andreas
Haberstroh, Edmund
Flock, Dustin
Reisgen, Uwe
Wagner, Nikolaus
Thermisches Spritzen : Potentiale, Entwicklungen, Märkte
In: Thermal spray bulletin, 1 (1), 30-36, 2008
Wielage, Bernhard
Rupprecht, Christian
Brühl, Markus
Richardt, Katharina Rebecca Maria
Ernst, Felix Björn Gustav
Bobzin, Kirsten
Auftraggelötete Verschleißschutzsysteme für Titanlegierungen
In: Schweissen und Schneiden, 60 (10), 566-570, 2008
Kopp, Nils
Schlegel, Arne
Ernst, Felix Björn Gustav
Bobzin, Kirsten
Microstructure based model for permeability predictions of open-cell metallic foams via homogenization
In: Materials science & engineering / A, Structural materials: properties, microstructure and processing, 472 (1/2), 214-226, 2008
[DOI: 10.1016/j.msea.2007.03.046]
Laschet, Gottfried
Kashko, Tatyana
Angel, Stefanie
Scheele, Josef
Nickel, Reimo
Bobzin, Kirsten
Bleck, Wolfgang
High-temperature brazing for reliable tungsten-CFC joints
In: Physica scripta, T128, 175-181, 2007
[DOI: 10.1088/0031-8949/2007/T128/034]
Koppitz, Th.
Pintsuk, G.
Reisgen, Uwe
Remmel, Josef
Hirai, T.
Sievering, R.
Rojas Yoris, Yelena
Casalegno, V.
Hydroxylapatite coatings by microplasma spraying
In: Wuji-cailiao-xuebao : jikan = Journal of inorganic materials, 22 (4), 754-758, 2007
[DOI: 10.3724/SP.J.1077.2007.00754]
He, Ding-Yong
Sun, Xu-Feng
Zhao, Lidong
Wear behavior of Cr1-xAlxNPVD-coatings in dry running conditions
In: Wear, 263 (7/12), 1274-1280, 2007
[DOI: 10.1016/j.wear.2007.01.118]
Bobzin, Kirsten
Lugscheider, Erich
Nickel, R.
Bagcivan, Nazlim
Krämer, A.
Microstructure dependency of the material properties: Simulation approaches and calculation methods for non-homogeneous materials
In: Steel research international, 78 (10/11), 804-811, 2007
Bobzin, Kirsten
Nickel, Reimo
Parkot, Daniel
Kashko, Tatyana
C-Schichten
In: WING, 2006, 2007
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
Yilmaz, Koray
Beschichtungsanlage für neue Werkstoffkombinationen : IOT mit Beschichtungsanlage der neuesten Generation
In: Werkstoffe in der Fertigung : die Fachzeitschrift für technische Führungskräfte, 2007 (6), 2007
Bobzin, Kirsten
Beschichtungsanlage für neue Werkstoffkombinationen : IOT mit Beschichtungsanlage der neuesten Generation
In: Aluminium : international journal for industry, research and application, 83, 81-81, 2007
Bobzin, Kirsten
Fügen mittels Kaltgasspritzen
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 98 (11), 2804-2805, 2007
Bobzin, Kirsten
Beschichtungsanlage für neue Werkstoffkombinationen : IOT mit Beschichtungsanlage der neuesten Generation
In: Journal für Oberflächentechnik : JOT, 6 (12), 2007
Bobzin, Kirsten
Entwicklung und Charakterisierung einer Nanocomposite nc-ZrC/a-C:H Beschichtung für den Einsatz in hydraulischen Verdrängereinheiten
In: Tribologie und Schmierungstechnik, 54 (4), 5-11, 2007
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Göbbels, Nico
Verschleißschutz für Titanbauteile
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 38 (2), 160-163, 2007
[DOI: 10.1002/mawe.200600106]
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Rösing, Jürgen
Rojas Yoris, Yelena
Hochtemperaturlöten als Reparaturverfahren zur Erweiterung der Lebensdauer einkristalliner Turbinenkomponenten
In: Schweissen und Schneiden, 59 (5), 249-252, 2007
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Rösing, Jürgen
Schlegel, Arne
Rojas Yoris, Yelena
Auftraglöten zum Verschleißschutz von Titanwerkstoffen
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 38 (7), 533-537, 2007
[DOI: 10.1002/mawe.200700164]
Bobzin, Kirsten
Ernst, F.
Rösing, J.
Rojas, Y.
Kaltgasspritzen von Al-basierten Lotwerkstoffen zum Löten von Aluminium und Aluminiumlegierungen
In: Info-Service / Fachgesellschaft Löten, 16, 16-18, 2007
Bobzin, Kirsten
Zhao, Lidong
Kutschmann, Pia
Investigation of particle flattening behaviour and bonding mechanisms of APS sprayed coatings on magnesium alloys
In: Surface & coatings technology, 201 (14), 6290-6296, 2007
[DOI: 10.1016/j.surfcoat.2006.11.034]
Bobzin, Kirsten
Lugscheider, Erich
Zwick, Jochen Bernt
Zhao, Lidong
Parco, Maria
Ökonomische und umweltverträgliche Umformtechnologien durch hochspezialisierte, funktionelle PVD-Werkzeugbeschichtungen
In: Jahrbuch Oberflächentechnik, 63, 64-70, 2007
Bobzin, Kirsten
Nickel, Reimo
Immich, Philipp
Pinero, Carmen
Warnke, Carsten
PVD-Coatings in injection molding machines for processing optical polymers
In: Plasma processes and polymers, 4 (Suppl. 1), S144-S149, 2007
[DOI: 10.1002/ppap.200730507]
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Manz, Florian
Determination of multi parametical transversely isotropic coating properties based on simulation of nanoindentation
In: International journal of surface science and engineering, 1 (2/3), 293-307, 2007
[DOI: 10.1504/IJSURFSE.2007.015030]
Bobzin, Kirsten
Nickel, Reimo
Parkot, Daniel
Hurevich, Vitalii
Göbbels, Nico
Application of thermal barrier coatings on open porous metallics foams
In: Plasma processes and polymers, 4.2007 (Suppl.1), S547-S550, 2007
[DOI: 10.1002/ppap.200731403]
Bobzin, Kirsten
Lugscheider, Erich
Nickel, Reimo
Bagcivan, Nazlim
Pulsed nanocomposite TiAlN coatings on complex shaped tools for high performance cutting operations
In: Plasma processes and polymers, 4.2007 (Suppl.1), S673-S676, 2007
[DOI: 10.1002/ppap.200731703]
Bobzin, Kirsten
Lugscheider, Erich
Nickel, Reimo
Immich, Philipp
Bolz, Stephan Frédéric
Klocke, Fritz
Analyse von Partikeleigenschaften beim Thermischen Spritzen von Mikropulvern
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 38 (2), 149-154, 2007
[DOI: 10.1002/mawe.200600109]
Bobzin, Kirsten
Lugscheider, Erich
Ernst, Felix Björn Gustav
Zwick, Jochen Bernt
Matthäus, Götz
Modeling and simulation in the production process control and material property calculation of complex structured EB-PVD TBCs
In: Computational materials science, 39 (3), 600-610, 2007
[DOI: 10.1016/j.commatsci.2006.08.011]
Bobzin, Kirsten
Lugscheider, Erich
Nickel, Reimo
Beschichtung von Zylinderlaufflächen moderner PKW-Motoren mit niedriglegierten Stählen und einem nanokristallinen Kompositwerkstoff
In: Tribologie und Schmierungstechnik, 54 (2), 11-16, 2007
Bobzin, Kirsten
Lugscheider, Erich
Ernst, Felix Björn Gustav
Zwick, Jochen Bernt
Schläfer, Thomas
Study on cold spraying of Al-based brazing alloys
In: Journal of thermal spray technology : JTST, 13 (2), 29-36, 2007
Zhao, Lidong
Zwick, Jochen Bernt
Ernst, Felix Björn Gustav
Bobzin, Kirsten
Lugscheider, Erich
Numerical studies of the application of shock tube technology for cold gas dynamic spray process
In: Journal of thermal spray technology : JTST, 16 (5/6), 729-735, 2007
[DOI: 10.1007/s11666-007-9123-7]
Nickel, Reimo
Bobzin, Kirsten
Lugscheider, Erich
Parkot, Daniel
Varava, Waldemar
Olivier, Herbert
Luo, Xisheng
Open porous metallic foams with thermal barrier coating and cooling hole array for high temperature turbine applications
In: High temperature material processes, 11 (3), 321-343, 2007
[DOI: 10.1615/HighTempMatProc.v11.i3.20]
Angel, Stefanie
Ratte, Evelin
Bleck, Wolfgang
Bobzin, Kirsten
Lugscheider, Erich
Nickel, R.
Richardt, Katharina Rebecca Maria
Bagcivan, Nazlim
Walther, K.
Kreutz, E. W.
Kelbassa, Ingomar
Poprawe, Reinhart
PVD-Beschichtungen für trockenlaufende Hybridwälzlager
In: Vakuum in Forschung und Praxis : VIP, 19 (2), 6-12, 2007
[DOI: 10.1002/vipr.200700313]
Gold, Peter Werner
Loos, Jörg
Plogmann, Michael
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Krämer, Anika
Grain size evaluation of pulsed TiAlN nanocomposite coatings for cutting tools
In: Thin Solid Films, 515 (3), 3681-3684, 2006
[DOI: 10.1016/j.tsf.2006.11.002]
Bobzin, Kirsten
Lugscheider, E.
Maes, M.
Immich, P.
Bolz, S. (Corresponding author)
Wirtschaftliche Kaltmassivumformung - Neue Werkzeugbeschichtungen machen Verzicht auf Bonderbehandlung möglich
In: Industrie-Anzeiger, 34/35, 43-43, 2006
Bobzin, Kirsten
Klocke, Fritz
Zeppenfeld, Christoph
Maßmann, Thomas Christoph
Maes, Michael
Pinero, Carmen
Raedt, Hans-Willi
Investigation of HVOF spraying on magnesium alloys
In: Surface and coatings technology, 201 (6), 3269-3274, 2006
[DOI: 10.1016/j.surfcoat.2006.06.047]
Parco, Maria (Corresponding author)
Zhao, Lidong
Zwick, Jochen Bernt
Bobzin, Kirsten
Lugscheider, Erich
Improvement of thermally sprayed abradable coating by microstructure control
In: Surface & coatings technology, 201 (6), 2303-2312, 2006
[DOI: 10.1016/j.surfcoat.2006.03.047]
Faraoun, H. I.
Grosdidier, T.
Seichepine, J.-L.
Goran, D.
Aourag, H.
Coddet, C.
Zwick, Jochen Bernt
Hopkins, Noel
Alternative methods for determination of composition and porosity in abradable materials
In: Materials characterization, 57 (1), 17-29, 2006
[DOI: 10.1016/j.matchar.2005.12.004]
Matejicek, Jiri
Kolman, Blahoslav
Dubsky, Jiri
Neufuss, Karel
Hopkins, Noel
Zwick, Jochen Bernt
Modelling route for abradable coatings
In: Surface & coatings technology, 200 (22/23), 6578-6582, 2006
[DOI: 10.1016/j.surfcoat.2005.11.105]
Faraoun, H. I.
Seichepine, J. L.
Coddet, C.
Aourag, H.
Zwick, Jochen Bernt
Hopkins, Noel
Sporer, Dieter
Hertter, M.
High kinetic process developments in thermal spray technology
In: Journal of thermal spray technology : JTST, 15 (2), 155-156, 2006
[DOI: 10.1361/105996306X108246]
Lugscheider, Erich
Thermal spraying developments
In: Advanced engineering materials, 8 (7), 595-596, 2006
Berndt, C.
Bobzin, Kirsten
Coddet, C.
Fauchais, P.
Lugscheider, Erich
Möhwald, K.
Singheiser, L.
Vardelle, A.
C-Schichten
In: WING : das Jahrbuch ; Projekte, Events und Ergebnisse / Projektträger Jülich, Forschungszentrum Jülich GmbH, 2006
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Yilmaz, Koray
HyDraNo - Leistungsteigerung in hydraulischen Verdrängereinheiten durch Nanocomposites
In: WING : das Jahrbuch, 2006, 97-97, 2006
Bobzin, Kirsten
Nickel, Reimo
Bagcivan, Nazlim
Göbbels, Nico
NaCoLab : Nanokristalline Composit-Beschichtungen für Zylinderlaufbahnen mit nanostrukturierter Oberfläche und Verschleißvorhersage für hochbelastete Benzin- und Dieselmotoren
In: WING : das Jahrbuch, 2006, 29-29, 2006
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Zwick, Jochen Bernt
Schläfer, Thomas
Qualitätssicherung durch online Prozessdiagnostik
In: Metalloberfläche : mo, 60 (11), 44-48, 2006
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Richardt, Katharina Rebecca Maria
Zwick, Jochen Bernt
Landes, Klaus
Forster, G.
Zierhut, Jochen
Aufwendige Vorbehandlung erübrigt sich : Werkzeugbeschichtungen: Kaltmassivumformen wird Effizienter
In: Industrie-Anzeiger, 128 (35), 43-43, 2006
Klocke, Fritz
Zeppenfeld, Christoph
Maßmann, Thomas Christoph
Bobzin, Kirsten
Maes, Michael
Pinero, Carmen
Raedt, Hans-Willi
Filgertshofer, Robert
Werkzeugbeschichtung: Verlagerung bringt Vorteile
In: Werkzeug & Formenbau, 16 (4), 27-27, 2006
Klocke, Fritz
Zeppenfeld, Christoph
Maßmann, Thomas Christoph
Bobzin, Kirsten
Maes, Michael
Pinero, Carman
Raedt, Hans-Willi
Filgertshofer, Robert
Umwelt schonende und wirtschaftliche Kaltmassivumformung
In: Der Schnitt- & Stanzwerkzeugbau, 10 (4), 59-60, 2006
Bobzin, Kirsten
Maes, Michael
Pinero, Carmen
Klocke, Fritz
Zeppenfeld, Christoph
Maßmann, Thomas Christoph
Raedt, Hans-Willi
Filgertshofer, Robert
Statt der Teile die Werkzeuge beschichten : Kaltmassivumformung: Auf Bondern gänzlich verzichten
In: Produktion : Technik und Wirtschaft für die deutsche Industrie, 45 (18), 10-10, 2006
Klocke, Fritz
Zeppenfeld, Christoph
Maßmann, Thomas Christoph
Bobzin, Kirsten
Maes, Michael
Pinero, Carmen
Raedt, Hans-Willi
Filgertshofer, Robert
Umwelt schonende und wirtschaftliche Kaltmassivumformung
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 97 (6), 1526-1527, 2006
Bobzin, Kirsten
Maes, Michael
Pinero, Carmen
Klocke, Fritz
Zeppenfeld, Christoph
Maßmann, Thomas Christoph
Raedt, Hans-Willi
Filgertshofer, Robert
The Influence of Substrate Preparation on the PVD Coating Graded Zirconium Carbide (ZrCg) and Chromium Aluminium Nitride (CrAlN)
In: Thin solid films, 2006, 2006
Bobzin, Kirsten
Bagcivan, Nazlim
Göbbels, Nico
Manz, Florian
Deposition of HA coatings by microplasma spraying
In: Das Dental-Labor, 7 (1), 126-126, 2006
[DOI: 10.1515/BIOMAT.2006.7.1.7]
Bobzin, Kirsten
Zwick, Jochen Bernt
Zhao, Lidong
Umweltverträgliche Kaltmassivumformung - PVD-Beschichtung statt bondern
In: Journal für Oberflächentechnik : JOT, 2006 (1), 30-31, 2006
Bobzin, Kirsten
Lugscheider, Erich
Nickel, Reimo
Immich, Philipp
Pinero, Carmen
Warnke, Carsten
Klocke, F.
Maßmann, Th.
Liauw, M.
Eichholz, S.
Raedt, H.-W.
Filgertshofer, R.
Investigation on the Thermal Behavior of Graded and Multilayered Lanthanum Zirconate as EB-PVD Thermal Barrier Coating
In: Journal of vacuum science & technology / A, Vacuum, surfaces, & films, 24 (4), 2006
Bobzin, Kirsten
Lugscheider, Erich
Bagcivan, Nazlim
Funktionelle Oberflächenbeschichtungen durch Plasmaspritzen
In: PlasmaNews, 2006 (1), 2006
Bobzin, Kirsten
Lugscheider, Erich
Zwick, Jochen Bernt
Eigenspannungsreduzierende Maßnahmen für flächige Lötverbindungen in der Mikrosytemtechnik
In: Schweissen und Schneiden, 58 (5), 238-246, 2006
Bach, Friedrich-Wilhelm
Holländer, Ulrich
Bobzin, Kirsten
Varava, Waldemar
Möhwald, Kai
Roxlau, Christian
Nickel, Reimo
Völlig abgelöst - PVD-Schichtsystem verhindert anhaftende Schmelze an Spritzgiessmaschinen
In: Der Plastverarbeiter : PV, 57 (8), 42-42, 2006
Bobzin, Kirsten
Bagcivan, Nazlim
Manz, Florian
PVD-Beschichtungen auf Plastifizierschnecken
In: Kunststoffe / [Deutsche Ausgabe], 96 (8), 66-68, 2006
Michaeli, Walter
Bobzin, Kirsten
Heßner, Sebastian
Neuß, Andreas
Manz, Florian
CrAlN-PVD-Niedertemperaturbeschichtung zum Verschleißschutz von Bauteilen
In: Tribologie und Schmierungstechnik, 53 (1), 2889-2898, 2006
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Einsatz von PVD/CVD-Schichten bei Wälzlagern
In: Jahrbuch Oberflächentechnik, 62, 106-124, 2006
Bobzin, Kirsten
Maes, Michael
Production and characterization of NiAl-Ta-Cr intermetallic coatings sprayed by high velocity oxy-fuel
In: Xiyou-jinshu-cailiao-yu-gongcheng = Rare metal materials and engineering, 35 (6), 974-977, 2006
Zhao, Lidong
He, Dingyong
Bobzin, Kirsten
Lugscheider, Erich
Application of multiscale modeling in the coating formation simulation of APS PYSZ TBCs
In: Journal of thermal spray technology : JTST, 15 (4), 537-544, 2006
[DOI: 10.1361/105996306X147063]
Lugscheider, Erich
Bobzin, Kirsten
Nickel, Reimo
Study on the influence of plasma spray processes and spray parameters on the structure and crystallinity of hydroxylapatite coatings
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 37 (6), 516-520, 2006
[DOI: 10.1002/mawe.200600029]
Zhao, Lidong
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Zwick, Jochen Bernt
Lugscheider, Erich
(Cr1-x,Alx)N ein Review über ein vielseitig einsetzbares Schichtsystem
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 37 (10), 833-841, 2006
[DOI: 10.1002/mawe.200600048]
Bobzin, Kirsten
Lugscheider, Erich
Nickel, R.
Immich, Philipp
Thermal cycling behavior of yttria stabilized zirconia and lanthanum zirconate, as graded and bilayer EB-PVD thermal barrier coatings
In: High temperature material processes, 10 (1), 103-115, 2006
[DOI: 10.1615/HighTempMatProc.v10.i1.80]
Bobzin, Kirsten
Lugscheider, Erich
Bagcivan, Nazlim
Alumina PVD tool coatings for the use in semi solid metal forming of steel
In: Diffusion and defect data - solid state data : Pt. B. Solid state phenomena, 116/117, 704-707, 2006
[DOI: 10.4028/www.scientific.net/SSP.116-117.704]
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Immich, Philipp
Microstructure and properties of atmospheric plasma sprayed AP40 bioactive glass-ceramic coatings
In: Wuji-cailiao-xuebao : jikan = Journal of inorganic materials, 21 (3), 759-763, 2006
[DOI: 10.3724/SP.J.1077.2006.00759]
He, Ding-Yong
Zhao, Lidong
Bobzin, Kirsten
Lugscheider, Erich
New soldering processes and solder systems for hybrid microsystems : developments and applications
In: Microsystem technologies, 12 (7), 620-625, 2006
[DOI: 10.1007/s00542-006-0079-1]
Bobzin, Kirsten
Lugscheider, Erich
Zhuang, H.
Ernst, Felix Björn Gustav
Bagcivan, Nazlim
Maes, Michael
Rösing, J.
Ferrara, Stefania
Erdle, Anja
Krämer, A.
Atmospheric plasma spraying of thermal barrier coating material ZrO2-7%/Y2O3 using on-line particle monitoring
In: Advanced engineering materials, 8 (4), 268-270, 2006
[DOI: 10.1002/adem.200500272]
Zhao, Lidong
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Lugscheider, Erich
Feasibility study of brazing aluminium alloys through pre-deposition of a braze alloy by cold spray process
In: Advanced engineering materials, 8 (8), 751-753, 2006
[DOI: 10.1002/adem.200600001]
Zhao, Lidong
Bobzin, Kirsten
Ernst, Felix Björn Gustav
Zwick, Jochen Bernt
Rösing, Jürgen
Lugscheider, Erich
Assessment of the microplasma spraying process for coating application
In: Advanced engineering materials, 8 (7), 635-639, 2006
[DOI: 10.1002/adem.200600054]
Lugscheider, Erich
Bobzin, Kirsten
Zhao, Lidong
Zwick, Jochen Bernt
Deposition of aluminium alloy Al12Si by cold spraying
In: Advanced engineering materials, 8 (4), 264-267, 2006
[DOI: 10.1002/adem.200500227]
Zhao, Lidong
Bobzin, Kirsten
He, Dingyong
Zwick, Jochen Bernt
Ernst, Felix Björn Gustav
Lugscheider, Erich
Carbon based tool coatings as an approach for environmentally friendly metal forming processes
In: Wear, 260 (3), 287-295, 2006
[DOI: 10.1016/j.wear.2005.04.026]
Klocke, Fritz
Maßmann, Thomas Christoph
Bobzin, Kirsten
Lugscheider, Erich
Bagcivan, Nazlim
Advanced homogenization strategies in material modeling of thermally sprayed TBCs
In: Advanced engineering materials, 8 (7), 663-669, 2006
[DOI: 10.1002/adem.200600046]
Bobzin, Kirsten
Lugscheider, Erich
Nickel, Reimo
Kashko, Tatyana
Thermal cycling behaviour of lanthanum zirconate as EB-PVD thermal barrier coating
In: Advanced engineering materials, 8 (7), 653-657, 2006
[DOI: 10.1002/adem.200600055]
Bobzin, Kirsten
Lugscheider, Erich
Bagcivan, Nazlim
The influence of hot isostatic pressing on plasma sprayed coatings properties
In: Surface & coatings technology, 201 (3/4), 1224-1227, 2006
[DOI: 10.1016/j.surfcoat.2006.01.046]
Abdel-Samad, Abdou
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
Relation of hardness and oxygen flow of Al2O3 coatings deposited by reactive bipolar pulsed magnetron sputtering
In: Thin solid films, 494 (1/2), 255-262, 2006
[DOI: 10.1016/j.tsf.2005.08.162]
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Pinero, Carmen
Integrated approach for the development of advanced, coated gas turbine blades
In: Advanced engineering materials, 8 (6), 535-562, 2006
[DOI: 10.1002/adem.200500277]
Herzog, R.
Warnken, Nils
Steinbach, Ingo
Hallstedt, Bengt
Walter, C.
Müller, Jochen
Hajas, David E.
Münstermann, Ernst
Schneider, Jochen M.
Nickel, Reimo
Parkot, Daniel
Bobzin, Kirsten
Lugscheider, Erich
Bednarz, P.
Trunova, O.
Singheiser, Lorenz
A systematic approach to material eligibility for the cold-spray process
In: Journal of thermal spray technology : JTST, 14 (1), 125-133, 2005
[DOI: 10.1361/10599630522738]
Vlcek, J.
Gimeno, L.
Huber, H.
Lugscheider, Erich
Metallographic investigations of composite structures of aluminium foam with thermally sprayed coatings
In: Praktische Metallographie = Practical metallography, 42 (1), 5-14, 2005
Maurer, Matthias Josef
Koch, Dieter
Zhao, Lidong
Lugscheider, Erich
Superelastic (Cr,Al)N coatings for high end spindle bearings
In: Surface & coatings technology, 200.2006 (5/6), 1738-1744, 2005
[DOI: 10.1016/j.surfcoat.2005.08.043]
Brecher, Christian
Spachtholz, Guido
Bobzin, Kirsten
Lugscheider, Erich
Knotek, Otto
Maes, Michael
PVD-Beschichtungen schützen die Kontaktpartner
In: Facts - CemCon, 2005 (24), 8-9, 2005
Brecher, Christian
Bobzin, Kirsten
Maes, Michael
Gold, Peter Werner
Kuhn, Marius
Bugiel, Christoph
Hybridprozesstechnik zur Plasmasynthese temperaturbeständiger Kohlenstoffschichten
In: WING : das Jahrbuch, 2005, 2005
Bobzin, Kirsten
Lugscheider, Erich
Bagcivan, Nazlim
Innovative PVD-Beschichtungen für das Thixoforming von Stahl
In: Jahrbuch Oberflächentechnik, 61, 2005
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Plasmalöten von Aluminium- und Magnesiumlegierungen
In: Der Praktiker, 97, 118-119, 2005
Bobzin, Kirsten
Lugscheider, Erich
Ernst, Felix Björn Gustav
Jäger, Doris
Rösing, J.
Aktuelle Entwicklungstrends in der thermischen Spritztechnik - eine Kurzübersicht
In: Schweissen und Schneiden, 57 (4), 137-140, 2005
Lugscheider, Erich
Bobzin, Kirsten
Zwick, J.
Established protective tool coatings for difficult machining operations
In: Journal of vacuum science & technology / A, Vacuum, surfaces, & films, 24.2006.4, 2005
Bobzin, Kirsten
Maes, Michael
Pinero, Carmen
Mikroplasmaspritzen ein Verfahren für kleine Bauteile
In: Schweissen und Schneiden, 57 (10), 564-568, 2005
Bobzin, Kirsten
Lugscheider, Erich
Zwick, J.
Zhao, Lidong
(C,Al)N Beschichtungen für Hoschgeschwindigkeitsspindellager, Proceedings: GfT- 46. Tribologiefachtagung 26.-28.09.05, Göttingen Vortrag 22, Band I
In: Tribologie und Schmierungstechnik, 53 (3/06), 17-21, 2005
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Investigation of the stability of tetragonal PVD zirconia coatings without dopants
In: International journal of adhesion & adhesives, 27.2007 (5 : Special issue), 2005
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
Immich, Philipp
Method of resolution to inhibit the growth of alumina in the intermetallic NiAl FG 75 alloy to increase TBC lifetime
In: Surface & coatings technology, 200.2005 (5/6), 2005
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Lackner, Kristijan
Einfluss von Silizium-Dotierungen auf das Reibverhalten von kohlenstoffbasierten PVD-Beschichtungen
In: Tribologie und Schmierungstechnik, 52 (6), 37-41, 2005
Lugscheider, Erich
Bobzin, Kirsten
Bagcivan, Nazlim
Laser drilled microholes in zirconia coated surfaces using two variants to implement the effusion cooling of first stage turbine blades
In: Advanced engineering materials, 7 (3), 145-152, 2005
[DOI: 10.1002/adem.200400148]
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
Lackner, K.
Poprawe, Reinhart
Kreutz, E. W.
Willach, J.
The effect of pulse sequence modulation and pulse energy on structural coating properties and coating composition
In: Surface & coatings technology, 200 (5/6), 1560-1565, 2005
[DOI: 10.1016/j.surfcoat.2005.08.064]
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Monte Carlo simulation of the PVD transport process for alloys
In: Surface & coatings technology, 200.2005 (1/4), 913-915, 2005
[DOI: 10.1016/j.surfcoat.2005.02.141]
Lugscheider, Erich
Bobzin, Kirsten
Papenfuß-Janzen, Nobert
Parkot, Daniel
Advancement in low melting solder deposition by pulsed magnetron sputter-PVD process for microsystemtechnology
In: Surface & coatings technology, 200.2005 (1/4), 444-447, 2005
[DOI: 10.1016/j.surfcoat.2005.02.193]
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
Ferrara, Stefania
Erdle, Anja
HVOF spraying of Al 2O 3-dispersion-strengthened NiCr powders
In: Surface & coatings technology, 182 (1), 72-77, 2004
[DOI: 10.1016/S0257-8972(03)00874-0]
Zhao, Lidong
Zwick, Jochen Bernt
Lugscheider, Erich
High velocity oxy-fuel thermal spraying of a NiCoCrAlY alloy
In: Surface & coatings technology, 179 (2/3), 272-278, 2004
[DOI: 10.1016/S0257-8972(03)00818-1]
Zhao, Lidong
Parco, Maria
Lugscheider, Erich
Characterisation and optimisation of innovative solders for transient liquid phase bonding and active soldering
In: Advanced engineering materials, 6 (3), 160-163, 2004
[DOI: 10.1002/adem.200300538]
Lugscheider, Erich
Ferrara, S.
Progress and developments in the field of materials for transient liquid phase bonding and active soldering processes
In: Microsystem technologies, 10 (3), 233-236, 2004
[DOI: 10.1007/s00542-003-0351-6]
Lugscheider, Erich
Ferrara, S.
Janssen, H.
Reimann, A.
Wildpanner, B.
Plasma diagnostics as a tool for the modeling and simulation of sputter processes
In: Surface & coatings technology, 177-178, 597-602, 2004
[DOI: 10.1016/j.surfcoat.2003.08.066]
Lugscheider, Erich
Papenfuss-Janzen, Norbert
The new easyFoam-process and mechanical properties of foam-coating-sandwiches
In: Advanced materials, 6 (11), 893-896, 2004
[DOI: 10.1002/adem.200300523]
Maurer, M.
Zhao, Lidong
Lugscheider, Erich
Neue PVD-Schichtkonzepte für hoch beanspruchte Werkzeuge für umweltverträgliche Fertigungsprozesse
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 35 (10/11), 851-857, 2004
[DOI: 10.1002/mawe.200400804]
Bobzin, Kirsten
Lugscheider, Erich
Piñero, C.
Influence of spray parameters on the particle in-flight properties and the properties of HVOF coating of WC-CoCr
In: Wear, 257 (1/2), 41-46, 2004
[DOI: 10.1016/j.wear.2003.07.002]
Zhao, Lidong
Maurer, Matthias Josef
Fischer, Falko
Dicks, Robert
Lugscheider, Erich
Study of HVOF spraying of WC-CoCr using on-line particle monitoring
In: Surface & coatings technology, 185 (2/3), 160-165, 2004
[DOI: 10.1016/j.surfcoat.2003.12.024]
Zhao, Lidong
Maurer, Matthias Josef
Fischer, Falko
Lugscheider, Erich
Wear behaviour of Al2O3 dispersion strengthened MCrAlY coating
In: Surface & coatings technology, 184 (2/3), 298-306, 2004
[DOI: 10.1016/j.surfcoat.2003.10.055]
Zhao, Lidong
Parco, Maria
Lugscheider, Erich
Development of a superlattice (Ti,Hf,Cr)N coating for cold metal forming applications
In: Surface & coatings technology, 177/178.2004, 616-622, 2004
[DOI: 10.1016/S0257-8972(03)00935-6]
Lugscheider, Erich
Bobzin, Kirsten
Pinero, Carmen
Klocke, Fritz
Maßmann, Thomas Christoph
Lanthanzirkonat : ein innovatives Wärmedämmschichtmaterial
In: Vakuum in Forschung und Praxis : VIP, 16, 170-175, 2004
[DOI: 10.1002/vipr.200400229]
Lugscheider, Erich
Bobzin, Kirsten
Lackner, Kristijan
Modernste PVD-Dünnschichttechnologie erobert neue Märkte
In: Jahrbuch Oberflächentechnik, 60, 108-125, 2004
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
Herstellung eines Mikroaktors auf der Basis lasergestützter Strukturierung von PVD-abgeschiedenen Bimetallstrukturen
In: Produktion von Leiterplatten und Systemen : PLUS, 6 (5), 2004
Lugscheider, Erich
Bobzin, Kirsten
Erdle, Anja
Horn, A.
Pütz, U.
Kreutz, E. W.
Poprawa, R.
High-performance chromium aluminium nitride PVD coatings on roller bearings
In: Surface & coatings technology, 188/189.2004, 649-654, 2004
[DOI: 10.1016/j.surfcoat.2004.07.030]
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Gold, Peter Werner
Loos, J.
Kuhn, M.
PVD-Niedertemperaturbeschichtung für Bauteile zur Integration tribologischer Funktionen in die Oberfläche
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 35 (10/11), 843-850, 2004
[DOI: 10.1002/mawe.200400803]
Bobzin, Kirsten
Lugscheider, Erich
Maes, Michael
Plasma diagnostical comparison of the MSIP process of (Ti,Al)N with pulsed and dc power supplies using energy-resolved mass spectroscopy
In: Surface & coatings technology, 188/189, 164-167, 2004
[DOI: 10.1016/j.surfcoat.2004.08.011]
Lugscheider, Erich
Bobzin, Kirsten
Papenfuß-Janzen, Norbert
Maes, Michael
Parkot, Daniel
Active soft solder deposition by magnetron-sputter-ion-plating (MSIP)-PVD-process
In: Thin solid films, 447/448.2004, 327-331, 2004
[DOI: 10.1016/S0040-6090(03)01110-6]
Lugscheider, Erich
Bobzin, Kirsten
Erdle, Anja
On the coating of polymers : basic investigations
In: Thin solid films, 459.2004 (1/2), 313-317, 2004
[DOI: 10.1016/j.tsf.2003.12.134]
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
Krämer, Anika
Characterization of steel thixoforming tool materials by high temperature compression tests
In: Steel research international, 75.2004 (8/9), 569-576, 2004
Kopp, Reiner
Shimahara, Hideki
Schneider, Jochen M.
Kurapov, Denis
Telle, Rainer
Münstermann, Simon
Lugscheider, Erich
Abdel-Samad, Abdou
Bobzin, Kirsten
Maes, Michael
Thermal spraying of a nitrogen alloyed austenitic steel
In: Thin solid films, 424 (2), 213-218, 2003
[DOI: 10.1016/S0040-6090(02)01047-7]
Zhao, Lidong
Maurer, Matthias Josef
Lugscheider, Erich
Finite element simulation of a coating formation on a turbine blade during plasma spraying
In: Surface & coatings technology, 174-175, 475-481, 2003
[DOI: 10.1016/S0257-8972(03)00331-1]
Lugscheider, Erich
Nickel, R.
First results on duplex coatings without intermediate mechanical treatment
In: Surface & coatings technology, 174-175, 671-676, 2003
[DOI: 10.1016/S0257-8972(03)00578-4]
Kamminga, J. D.
Hoy, R.
Janssen, G. C. A.
Lugscheider, Erich
Maes, M.
Investigation of thermal spraying processes using simulation methods
In: Journal of materials processing technology, 26 (2), 217-226, 1991
[DOI: 10.1016/0924-0136(91)90135-2]
Elsing, Rainer
Knotek, Otto
Balting, U.
Oberflächen tunen - PVD/CVD-Dünnschichttechnologie
In: Metalloberfläche : mo, 57 (9), 33-37, 2003
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
Erosion- und brandrissmindernde PVD-Hartstoffschichten für Aluminium und Magnesium-Druckgießformen
In: International foundry research, 55 (3), 93-97, 2003
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
New concepts of graded zirconium carbide coatings for components
In: Surface & coatings technology, 177/178.2004, 2003
Lugscheider, Erich
Knotek, Otto
Bobzin, Kirsten
Maes, Michael
Low temperature deposition of CrAlN coatings for the application on machine parts
In: Surface & coatings technology, 177/178.2004, 2003
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
Increasing AlN amount in magnetron sputtered Cr(1-x)Al(x)N PVD-coatings for high temperature applications by means of pulsed power supplies
In: Surface & coatings technology, 177/178.2004, 2003
Lugscheider, Erich
Bobzin, Kirsten
Maes, Michael
Study on atmospheric plasma spraying of Al2O3 using on-line particle monitoring
In: Surface & coatings technology, 136/138 (2/3), 258-262, 2003
[DOI: 10.1016/S0257-8972(03)00201-9]
Lugscheider, Erich
Zhao, Lidong
Seemann, Klaus
Fischer, Arne
Influence of the spraying processes on the properties of 316L stainless steel coatings
In: Surface & coatings technology, 162 (1), 6-10, 2003
[DOI: 10.1016/S0257-8972(02)00560-1]
Lugscheider, Erich
Zhao, Lidong
The influence of milling parameters on the properties of the milled powders and the resultant coatings
In: Surface & coatings technology, 168 (2/3), 179-185, 2003
[DOI: 10.1016/S0257-8972(03)00202-0]
Lugscheider, Erich
Zwick, Jochen Bernt
Zhao, Lidong
Investigations of mechanical and tribological properties of CrAlN+C thin coatings deposited on cutting tools
In: Surface & coatings technology, 174/175.2003, 681-686, 2003
[DOI: 10.1016/S0257-8972(03)00566-8]
Lugscheider, Erich
Bobzin, Kirsten
Lackner, Kristijan
Determination of mechanical properties of electron beam-physical vapor deposition-thermal barrier coatings (EB-PVD-TBCs) by means of nanoindentation and impact testing
In: Surface & coatings technology, 163/164, 75-80, 2003
[DOI: 10.1016/S0257-8972(02)00594-7]
Bouzakis, K.-D.
Lontos, A.
Michailidis, N.
Knotek, Otto
Lugscheider, Erich
Bobzin, Kirsten
Etzkorn, Achim Helmut
Solder deposition for transient liquid phase (TLP)-bonding by MSIP-PVD-process
In: Surface & coatings technology, 174/175.2003, 704-707, 2003
[DOI: 10.1016/S0257-8972(03)00692-3]
Lugscheider, Erich
Bobzin, Kirsten
Erdle, Anja
Wettability of PVD compound materials by lubricant
In: Surface & coatings technology, 165 (1), 51-57, 2003
[DOI: 10.1016/S0257-8972(02)00724-7]
Lugscheider, Erich
Bobzin, Kirsten
In-flight reactions of metallic particles during thermal spraying
In: Advanced engineering materials, 4 (12), 922-924, 2002
[DOI: 10.1002/adem.200290005]
Zhao, Lidong
Herbst-Dederichs, C.
Lugscheider, Erich
Surface refinement of metal foams
In: Advanced engineering materials, 4 (10), 791-797, 2002
[DOI: 10.1002/1527-2648(20021014)4:10<791::AID-ADEM791>3.0.CO;2-Q]
Maurer, Matthias Josef
Zhao, Lidong
Lugscheider, Erich
High-temperature brazing of superalloys and stainless steels with novel ductile Ni-Hf-based filler metals
In: Advanced engineering materials, 4 (3), 138-142, 2002
[DOI: 10.1002/1527-2648(200203)4:3<138::AID-ADEM138>3.0.CO;2-Y]
Lugscheider, Erich
Humm, S.
High velocity oxy-fuel spraying of a NiCoCrAlY and an intermetallic NiAl-TaCr alloy
In: Surface & coatings technology, 149 (2/3), 230-235, 2002
[DOI: 10.1016/S0257-8972(01)01444-X]
Zhao, Lidong
Lugscheider, Erich
Process and advantage of multicomponent and multilayer PVD coatings
In: Surface & coatings technology, 59 (1/3), 14-20, 1993
[DOI: 10.1016/0257-8972(93)90048-S]
Knotek, O.
Löffler, Frank
Krämer, G.
Ceramic cathodes for arc-physical vapour deposition : development and application
In: Surface & coatings technology, 49 (1/3), 263-267, 1991
[DOI: 10.1016/0257-8972(91)90066-6]
Knotek, Otto
Löffler, Frank
Bohmer, M.
Breidenbach, R.
Stossel, C.
Amorphous carbon physically vapour deposited coatings
In: Surface & coatings technology, 49 (1/3), 370-373, 1991
[DOI: 10.1016/0257-8972(91)90085-B]
Knotek, Otto
Löffler, Frank
Brand, J.
Burgmer, W.
PVD-beschichtete Zerspanwerkzeuge für moderne Zerspanoperationen (Teil 1)
In: Stahl, 2002 (3), 45-47, 2002
Lugscheider, Erich
Bobzin, Kirsten
Hornig, Thomas
Colmenares, C.
PVD-beschichtete Zerspanwerkzeuge für moderne Zerspanoperationen (Teil 2)
In: Stahl, 2002 (4), 45-47, 2002
Lugscheider, Erich
Bobzin, Kirsten
Hornig, Thomas
Colmenares, C.
Übertragung tribologischer Funktionen der Schmierstoffe auf die Werkstoffoberfläche mittels PVD-Technologie
In: Tribologie und Schmierungstechnik, 49 (1), 16-20, 2002
Lugscheider, Erich
Bobzin, Kirsten
Wenn Schichten laufen wie geschmiert... : Moderne PVD-Schichten ersetzen umweltgefährdende Schmierstoff-Additive
In: RWTH-Themen : Berichte aus der Rheinisch-Westfälischen Technischen Hochschule Aachen, 2002 (1), 81-83, 2002
Beckers, Manfred
Lugscheider, Erich
Bobzin, Kirsten
Hornig, Th.
Das tribologische Verhalten von neu entwickelten PVD-Schichten für die umweltverträgliche Kaltumformung
In: Tribologie und Schmierungstechnik, 49 (6), 19-25, 2002
Lugscheider, Erich
Bobzin, Kirsten
Beckers, M.
Colmenares, C.
Klocke, F.
Raedt, H.-W.
Energy resolved ion mass spectroscopy of (Ti,Al)N hard coatings deposited by bipolar pulsed magnetron sputtering
In: Surface & coatings technology, 174/175, 2002
Lugscheider, Erich
Bobzin, Kirsten
Papenfuß-Janzen, Norbert
Erkens, Georg
Cremer, R.
Rambadt, S.
Reactive plasma spraying of TiAl6V4 alloy
In: Wear, 253 (11/12), 1214-1218, 2002
[DOI: 10.1016/S0043-1648(02)00246-6]
Lugscheider, Erich
Zhao, Lidong
Berechnung von Wärmebehandlungsprozessen - Welche Möglichkeiten hat der Praktiker? Teil I: Temperaturfelder und verwandte Eigenschaften wie Gefüge und Härte
In: Der Wärmebehandlungsmarkt : Daten, Fakten, Angebote / Dr. Sommer Werkstofftechnik GmbH, 2002 (3), 5-8, 2002
Elsing, Rainer
Graded EB-PVD-thermal barrier coatings produced by powder evaporation
In: Advanced engineering materials, 4 (12), 919-922, 2002
[DOI: 10.1002/adem.200290004]
Lugscheider, Erich
Bobzin, Kirsten
Etzkorn, Achim Helmut
Syrokas, G.
Siry, C. W.
Investigation of the residual stresses and mechanical properties of (Cr,Al)N arc PVD coatings used for semi-solid metal (SSM) forming dies
In: Thin solid films, 420/421, 318-323, 2002
[DOI: 10.1016/S0040-6090(02)00831-3]
Lugscheider, Erich
Bobzin, Kirsten
Hornig, Thomas
Maes, Michael
Testing and design of tool coatings with properties adapted to the use of biodegradable cutting fluids
In: CIRP annals : manufacturing technology, 50 (1), 57-60, 2001
[DOI: 10.1016/S0007-8506(07)62070-8]
Klocke, Fritz
Krieg, T.
Lugscheider, Erich
Bobzin, Kirsten
PVD-Beschichtungen lassen Kunststoffe kalt
In: Metalloberfläche : mo, 55 (10), 34-37, 2001
Lugscheider, Erich
Bobzin, Kirsten
Hornig, Thomas
Beckers, M.
Deposition of solder for micro-joining on M.E.M.S. components by means of magnetron sputtering
In: Surface & coatings technology, 142/144, 813-816, 2001
[DOI: 10.1016/S0257-8972(01)01182-3]
Lugscheider, Erich
Bobzin, Kirsten
Lake, Michael K.
Atomistic simulation of surface evolution during PVD coating processes
In: Surface & coatings technology, 142/144, 923-927, 2001
[DOI: 10.1016/S0257-8972(01)01316-0]
Lugscheider, Erich
Hayn, G. v.
Thermal spraying of a high nitrogen duplex austenitic-ferritic steel
In: Surface & coatings technology, 141 (2/3), 208-215, 2001
[DOI: 10.1016/S0257-8972(01)01233-6]
Lugscheider, Erich
Zhao, Lidong
Fischer, A.
Reimann, A.
Systematische Entwicklung gradierter ZrC und HfC Schichten für tribologische Anwendungen am Beispiel von hydraulischen Komponenten
In: Tribologie und Schmierungstechnik, 48 (1), 2001
Lugscheider, Erich
Bobzin, Kirsten
Burckhardt, M.
Murrenhoff, Hubertus
van Bebber, David
Metall-Kohlenstoffschichten (ZrCg und HfCg) für den Einsatz in hydraulischen Komponenten
In: O + P : Fluidtechnik für den Maschinen- und Anlagenbau, 45 (5), 361-, 2001
Murrenhoff, Hubertus
van Bebber, David
Lugscheider, Erich
Bobzin, Kirsten
Burckhardt, M.
Widening the usability of yttria stabilised zirconia by advanced cooling technology
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 32 (8), 660-664, 2001
[DOI: 10.1002/1521-4052(200108)32:8<660::AID-MAWE660>3.0.CO;2-G]
Lugscheider, Erich
Bobzin, Kirsten
Etzkorn, Achim Helmut
Characteristic curves of voltage and current phase generation and properties of tungsten- and vanadium-oxides deposited by reactive d.c.-MSIP-PVD-process for self-lubricating applications
In: Surface & coatings technology, 142/144, 137-142, 2001
[DOI: 10.1016/S0257-8972(01)01318-4]
Lugscheider, Erich
Knotek, Otto
Bärwulf, Stephan
Bobzin, Kirsten
The influence on surface free energy of PVD-coatings
In: Surface & coatings technology, 142/144, 755-760, 2001
[DOI: 10.1016/S0257-8972(01)01315-9]
Lugscheider, Erich
Bobzin, Kirsten
Mechanical properties of EB-PVD-thermal barrier coatings by nanoindentation
In: Surface & coatings technology, 138 (1), 9-13, 2001
[DOI: 10.1016/S0257-8972(00)01147-6]
Lugscheider, Erich
Bobzin, Kirsten
Bärwulf, Stephan
Etzkorn, Achim Helmut
A comparative study on thermally sprayed alumina based ceramic coatings
In: Journal of materials science : JMS, 35 (12), 3127-3130, 2000
[DOI: 10.1023/A:1004824104162]
Abdel-Samad, A. A.
El-Bahloul, A. M.
Lugscheider, Erich
Rassoul, S. A.
Erhöhung und Charakterisierung der Festigkeit von Metallschäumen für lasttragende Anwendungen durch thermisch gespritzte Verbundstrukturen
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 31 (6), 523-526, 2000
[DOI: 10.1002/1521-4052(200006)31:6<523::AID-MAWE523>3.0.CO;2-%23]
Maurer, Matthias Josef
Lugscheider, Erich
Tribological behaviour at room temperature and at 550°C of TiC-based plasma sprayed coatings in fretting gross slip conditions
In: Wear, 244 (1/2), 165-179, 2000
[DOI: 10.1016/S0043-1648(00)00455-5]
Economou, S.
de Bonte, M.
Celis, J. P.
Smith, R. W.
Lugscheider, Erich
Electron beam-physical vapor deposition - thermal barrier coatings on laser drilled surfaces for transpiration cooling
In: Surface & coatings technology, 133/134, 49-53, 2000
[DOI: 10.1016/S0257-8972(00)00872-0]
Lugscheider, Erich
Bobzin, Kirsten
Etzkorn, Achim Helmut
Horn, Alexander
Weichenhain, Ruth
Kreutz, Ernst Wolfgang
Poprawe, Reinhart
Functional metal based coatings on ceramic substrates
In: Surface & coatings technology, 132, 222-276, 2000
[DOI: 10.1016/S0257-8972(00)00868-9]
Löffler, Frank
Reactive plasma spraying of titanium
In: Advanced engineering materials, 2 (5), 281-284, 2000
[DOI: 10.1002/(SICI)1527-2648(200005)2:5<281::AID-ADEM281>3.3.CO;2-T]
Lugscheider, Erich
Zhao, Lidong
Fischer, Andreas
Benetzbarkeit von PVD-Werkstoffverbunden durch Schmierstoffe
In: Tribologie und Schmierungstechnik, 48 (2), 2000
Lugscheider, Erich
Bobzin, Kirsten
Tool coating deposited by PVD-processes for the protection against corrosion and wear of the aluminium thixoforming-process
In: Thin solid films, 377/378, 2000
Lugscheider, Erich
Knotek, Otto
Wolff, C.
Bärwulf, Stephan
Brazing of silicon nitride with reactive filler metals
In: Science and engineering of composite materials, 7 (3), 107-112, 2000
Lugscheider, Erich
Buschke, I.
Indacochea, J. E.
Tillmann, W.
Trehan, V.
Trickey, S.
On the oxidation of Ni-23Co-17Cr-12Al-0.5Y-Alloy serving as bond coat in thermal barrier coatings
In: High temperature material processes, 4 (3), 339-350, 2000
Haugsrud, R.
Kvernes, I.
Lugscheider, Erich
PVD-Dünnschichttechnologie für maßgeschneiderte Oberflächen
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 91 (9), 2580-2585, 2000
Lugscheider, Erich
Bobzin, Kirsten
Bärwulf, Stephan
Rockwell-Härteprüfmaschinen kalibrieren
In: Materialprüfung : MP, 42, 2000
Löffler, F.
Lotlegierungen und Lötverfahren zum flussmittelfreien Löten schwer benetzbarer Werkstoffe
In: Schweissen und Schneiden, 52 (8), 454-460, 2000
Hillen, Frank
Pickart-Castillo, Darmar
Rass, I. J.
Lugscheider, Erich
Simulation of heat transfer and residual stresses in plasma spray coating
In: News of Belarusian Academy of Science / Series of physic-technical science, 2000 (1), 134-141, 2000
Kuzmenkov, A.
Kundas, S.
Gurevich, V.
Lugscheider, Erich
Eritt, U.
Computer modelling of the plasma spraying process
In: The Paton welding journal, 12, 40-51, 2000
Lugscheider, Erich
Eritt, U.
Krivtsun, I. V.
Muzhichenko, A. F.
Yu, S.
Feinbleche aus verzinktem Stahl ohne Flussmittel hartlöten
In: Der Praktiker, 52 (3), 94-96, 2000
Lugscheider, Erich
Schlimbach, K.
Durch Pulver-Plasmaauftragschweißen Verschleißverhalten von Aluminiumlegierungen verbessern
In: Der Praktiker, 52 (4), 142-146, 2000
Lugscheider, Erich
Dilthey, Ulrich
Kabatnik, Lars
Langer, G.
Schlimbach, K.
PVD hard coatings protecting the surface of thixoforming tools
In: Advanced engineering materials, 2 (1/2), 33-37, 2000
[DOI: 10.1002/(SICI)1527-2648(200002)2:1/2<33::AID-ADEM33>3.0.CO;2-J]
Lugscheider, Erich
Bobzin, Kirsten
Bärwulf, Stephan
Hornig, T.
Durch Pulver-Plasmaauftragschweißen Verschleißverhalten von Aluminiumlegierungen verbessert
In: Der Praktiker, 52 (4), 142-148, 2000
Dilthey, Ulrich
Kabatnik, Lars
Lugscheider, Erich
Schlimbach, K.
Tribological properties, phase generation and high temperature phase stability of tungsten- and vanadium-oxides deposited by reactive MSIP-PVD process for innovative lubrication applications
In: Surface & coatings technology, 133/134 (1/3), 362-368, 2000
[DOI: 10.1016/S0257-8972(00)00963-4]
Lugscheider, Erich
Knotek, Otto
Bobzin, Kirsten
Bärwulf, Stephan
Oxidation characteristics and surface energy of chromium-based hardcoatings for use in semisolid forming tools
In: Surface & coatings technology, 133/134, 540-547, 2000
Lugscheider, Erich
Bobzin, Kirsten
Bärwulf, Stephan
Hornig, T.
Möglichkeiten zur Steigerung der Oberflächenfestigkeit bei Aluminiumlegierungen mit Plasma-Pulver-Schweißverfahren
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 30 (11), 697-702, 1999
[DOI: 10.1002/(SICI)1521-4052(199911)30:11<697::AID-MAWE697>3.3.CO;2-D]
Dilthey, Ulrich
Kabatnik, Lars
Lugscheider, Erich
Schlimbach, K.
Langer, G.
Investigation of the mechanical and structural properties of Ti-Hf-C-N are PVD coatings
In: Surface & coatings technology, 116, 239-243, 1999
[DOI: 10.1016/S0257-8972(99)00115-2]
Lugscheider, E.
Knotek, O.
Zimmermann, H.
Hellmann, S.
Magnetron sputtered titanium nitride thin films on thermoplastic polymers
In: Surface & coatings technology, 116, 1172-1178, 1999
[DOI: 10.1016/S0257-8972(99)00157-7]
Lugscheider, E.
Bärwulf, S.
Riester, M.
Hilgers, H.
Effect of thermal aging on the erosion resistance of air plasma sprayes zirconia thermal barrier coating
In: Surface & coatings technology, 113 (3), 278-285, 1999
[DOI: 10.1016/S0257-8972(99)00002-X]
Lugscheider, Erich
Remer, P.
Janos, B. Z.
Superhard PVD coatings in the B-N-C triangle
In: International journal of refractory and hard metals : R & HM, 17 (1/3), 157-162, 1999
[DOI: 10.1016/S0263-4368(98)00066-3]
Lugscheider, Erich
Knotek, Otto
Syri, C. W.
Simulation of the film growth and film-substrate mixing during the sputter deposition process
In: Surface & coatings technology, 116/119, 568-572, 1999
Lugscheider, Erich
Hayn, G. v.
Morphology of sputtered titanium nitride thin films on thermoplastic polymers
In: Surface & coatings technology, 116/119, 1001-1005, 1999
Lugscheider, Erich
Riester, M.
Bärwulf, Stephan
Hilgers, H.
PVD-hard coated reamers in lubricant - free cutting
In: Surface & coatings technology, 112, 146-151, 1999
[DOI: 10.1016/S0257-8972(98)00775-0]
Lugscheider, Erich
Knotek, Otto
Barimani, Cyrus
Leyendecker, T.
Lemmer, O.
Wenke, R.
Wenke, R.
Properties of tungsten and vanadium oxides deposited by MSIP-PVD process for self-lubricating applications
In: Surface & coatings technology, 120/121, 458-464, 1999
Lugscheider, Erich
Barimani, Cyrus
Bärwulf, Stephan
Magnetron sputtered titanium nitride thin films on thermoplastic polymeres
In: Surface & coatings technology, 116/119, 1172-1178, 1999
Lugscheider, Erich
Bärwulf, Stephan
Riester, M.
Hilgers, H.
Entwicklung einer Technologie zum flußmittelfreien Löten verzinkten Stahls
In: Schweissen und Schneiden, 52 (4), 1999
Lugscheider, Erich
Schlimbach, K.
Optical emission spectroscopy studies of titanium nitride sputtering on thermoplastic polymers
In: Surface & coatings technology, 116/119, 981-985, 1999
[DOI: 10.1016/S0257-8972(99)00214-5]
Lugscheider, Erich
Neuhäuser, M.
Bärwulf, Stephan
Hilgers, H.
Riester, M.
Composition of the interface region of sputtered titanium nitride thin films on thermoplastic polymers
In: Surface & coatings technology, 116/119, 1179-1182, 1999
Lugscheider, Erich
Riester, M.
Bärwulf, Stephan
Hilgers, H.
Investigation of the mechanical and structural properties of Ti-Hf-C-N arc PVD coatings
In: Surface & coatings technology, 116/119, 1999
Lugscheider, Erich
Knotek, Otto
Zimmermann, H.
Hellmann, S.
Synthetische Ester und PVD-beschichtete Bauteile als Elemente umweltverträglicher Tribosysteme
In: Tribologie und Schmierungstechnik, 46 (10), 1999
Murrenhoff, Hubertus
Remmelmann, Andreas
Lugscheider, Erich
Bobzin, Kirsten
Investigations of the mechanical and structural properties of Ti-Hf-C-N Arc PVD coatings
In: Surface & coatings technology, 116/119, 239-243, 1999
Lugscheider, Erich
Knotek, Otto
Zimmermann, H.
Hellmann, S.
Herstellung und Eigenschaftsbestimmung dünner Auftraglotschichten
In: Schweissen und Schneiden, 51 (5), 1999
Lugscheider, Erich
Structure and properties of PVD-coatings by means of impact tester
In: Surface & coatings technology, 116/119, 141-146, 1999
Lugscheider, Erich
Knotek, Otto
Wolff, C.
Bärwulf, Stephan
The effect of PVD layer constitution on surface free energy
In: Thin solid films, 355/356 (1), 367-373, 1999
[DOI: 10.1016/S0040-6090(99)00543-X]
Lugscheider, Erich
Bobzin, Kirsten
Möller, M.
Parameter studies on high-velocity oxy-fuel spraying of MCrAlY coatings
In: Surface & coatings technology, 108 (1/3), 16-23, 1998
[DOI: 10.1016/S0257-8972(98)00630-6]
Lugscheider, Erich
Herbst-Dederichs, Christian
Zhao, Lidong
Corrosion tests of PVD coatings with die lubricant used for Al high-pressure die-casting dies
In: Surface & coatings technology, 108 (1/3), 408-412, 1998
[DOI: 10.1016/S0257-8972(98)00624-0]
Lugscheider, E.
Barimani, C.
Guerreiro, S.
Bobzin, Kirsten
Beschichtungen lassen Werkzeuge kalt
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 29 (9), 525-536, 1998
[DOI: 10.1002/mawe.19980290911]
Lugscheider, E.
Knotek, O.
Konig, W.
Stock, H. R.
Hellman, S.
Zimmermann, H.
Lake, M. K.
Fritsch, R.
Seidel, F.
Innenbeschichtung von Al-Motorblöcken mittels PVD-Technik
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 29 (12), 720-725, 1998
[DOI: 10.1002/mawe.19980291207]
Lugscheider, E.
Wolff, C.
Plasma-Pulverauftragschweißen - Vergleich von Standard- und Hochleistungsprozeß
In: Schweissen und Schneiden, 50 (2), 96-101, 1998
Lugscheider, Erich
Langer, G.
Simulation von Gleitverschleiß
In: Metall, 52, 643-651, 1998
Peterseim, J.
Elsing, R.
Deuerler, F.
Das Interview
In: Schweissen und Schneiden, 50, 332-333, 1998
Lugscheider, E.
Parameter studies on high-velocity oxy-fuel spraying of MCrAIY coatings
In: Thin solid films, ..., 1998
Lugscheider, E.
Zhao, L.
Herbst, C.
Parameter studies on high-velocity oxy-fuel spraying of MCrAIY coatings
In: Surface & coatings technology, 108/109, 16-23, 1998
Lugscheider, E.
Zhao, L.
Herbst, C.
Magnetronsputtered hard material coatings on thermoplastic polymers for clean room applications
In: Thin solid films, ..., 1998
Lugscheider, Erich
Bärwulf, Stephan
Barimani, Cyrus
Riester, M.
Hilgers, H.
Investigation of new arc PVD coatings in the system Ti-Hf-C-N
In: Thin solid films, ..., 145-145, 1998
Lugscheider, E.
Knotek, O.
Zimmermann, H.
Stricker, S.
Corrosion tests of PVD coatings with die dressing used for Al high-pressure die-casting dies
In: Thin solid films, ..., 1998
Lugscheider, Erich
Barimani, Cyrus
Guerreiro, S.
Bobzin, Kirsten
Vergleich verschiedener Meßmethoden zur Bestimmung der Partikelgröße von Pulvern zum Plasmaspritzen
In: Schweissen und Schneiden, 50, 724-731, 1998
Lugscheider, E.
Suk, H.-G.
Lee, H.-K.
Beschichtungstechnologien entwickeln sich mit den Anforderungen: Über den Masseneinsatz entscheidet ein konsequent durchgeführtes Qualitätsmanagement
In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 7 (2), 12-13, 1998
Lugscheider, E.
Analysis of a-BxCy:Hz coatings with IBA techniques
In: Nuclear instruments & methods in physics research / Section B, Beam interactions with materials and atoms, 136/138, 258-262, 1998
Lugscheider, Erich
Giorginis, G.
Persson, L.
Hult, M.
Siry, C. W.
Crametz, A.
Innenbeschichtung von Aluminium Motorblöcken mittels PVD-Technik - Teil 1
In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 89 (2), 40-42, 1998
Lugscheider, Erich
Wolff, C.
Processing, structure and tribological behaviour of TiC-reinforced plasma sprayed coatings
In: Wear, 220 (1), 34-50, 1998
[DOI: 10.1016/S0043-1648(98)00237-3]
Economou, S.
de Bonte, Marc
Celis, Jean-Pierre
Smith, R. W.
Lugscheider, Erich
Plasma-arc powder surfacing - comparison of standard and high-productivity processes
In: Schweissen und Schneiden, 50, E28-E31, 1998
Lugscheider, Erich
Langer, G.
Wie High-Tech Beschichtungen laufen lernen : Oberflächenmodifikation an Bauteilen für die Medizintechnik
In: RWTH-Themen : Berichte aus der Rheinisch-Westfälischen Technischen Hochschule Aachen, 1998, 40-42, 1998
Kyeck, Sascha
Lake, Mark
Lugscheider, Erich
High-speed flame-sprayed chromium coatings for wear and corrosion protection
In: Schweissen und Schneiden, 50, E36-E39, 1998
Lugscheider, Erich
Reymann, H.
Ceramic thermal barrier coatings deposited with the electron beam-physical vapour deposition technique
In: Surface & coatings technology, 98 (1/3), 1221-1227, 1998
Lugscheider, Erich
Barimani, Cyrus
Döpper, G.
Hochgeschwindigkeitsflammgespritzte Chromschichten zum Verschleiß- und Korrosionsschutz
In: Schweissen und Schneiden, 50 (1), 44-47, 1998
Lugscheider, Erich
Reymann, H.
(Cr:Al)N coatings deposited by cathodic vacuum ARC evaporation
In: Surface & coatings technology, 98 (1/3), 1233-1239, 1998
[DOI: 10.1016/S0257-8972(97)00238-7]
Lugscheider, Erich
Vetter, J.
Guerreiro, S.
Heat-resistant active brazing of silicon-nitride. Part 2: Metallurgical characterization of the braze joints
In: Welding journal, 77 (Suppl.), 103-109, 1998
Lugscheider, Erich
Tillmann, W.
Schlimbach, K.
Manter, C.
Indacochea, C. A.
Comparison of different measuring methods for the determination of the particle size of powders for plasma spraying
In: Schweissen und Schneiden, 50, E219-E222, 1998
Lugscheider, Erich
Suk, H.-G.
Lee, H.-K.
On the thermoelectric performance of plasma spray-formed iron disilicide
In: Journal of materials science / Letters, 17, 1487-1490, 1998
Lugscheider, Erich
Schilz, J.
Müller, E.
Schakenberg, K.
Ernst, H.
Kaysser, W. A.
Langer, G.
Wear and cutting performance of coated microdrills
In: Surface & coatings technology, 107, 191-196, 1998
Löffler, F.
Corrosion tests of PVD coatings with die dressing used for Al high-pressure die-casting dies
In: Surface & coatings technology, 108/109, 408-412, 1998
Lugscheider, Erich
Barimani, Cyrus
Guerreiro, S.
Bobzin, Kirsten
Magnetron-sputtered hard material coatings on thermoplastic polymers for clean room applications
In: Surface & coatings technology, 108/109, 398-402, 1998
Lugscheider, Erich
Bärwulf, Stephan
Barimani, Cyrus
Riester, C.
Hilgers, H.
Investigations on hard coated reamers in different lubricant free cutting operations
In: Surface & coatings technology, 90 (1/2), 172-177, 1997
[DOI: 10.1016/S0257-8972(96)03114-3]
Lugscheider, Erich
Knotek, O.
Barimani, C.
Leyendecker, T.
Lemmer, O.
Wenke, R.
Induktives Auftragslöten von Verschleißschutzschichtenim kontinuierlichn Verfahrbetrieb
In: Schweissen und Schneiden, 49 (6), 356-358, 1997
Lugscheider, Erich
Schmoor, H.
Heat-resistant active brazing of silicon-nitride. P. 1: Mechanical evaluation of braze joints - a new class of palladium-based filler metals that wet to ceramics is tested for joint strenght and oxidation resistance
In: Welding journal, 76 (8), 300-304, 1997
Tillmann, W.
Schlimbach, K.
Manter, C.
Indacochea, J. E.
Lugscheider, Erich
PVD coatings for lubricant-free tribological applications
In: Wear, 209, 101-105, 1997
Knotek, O.
Lugscheider, Erich
Barimani, Cyrus
Möller, M.
Development and characterization of joining techniques for dispersion-strenghtened alumina
In: Welding journal, 76 (9), 349-355, 1997
Lugscheider, Erich
Burger, W.
Broich, U.
Fügen und Beschichten in der Produktion der Zukunft - Untersuchung von acht deutschen Forschungsinstituten innerhalb des Rahmenprojekts Produktion 2000
In: Der Praktiker, 49 (11), 516-520, 1997
Lugscheider, Erich
Kortenbruck, G.
von Hofe, D.
Structure and properties of PVD TiB2-Coatings
In: Journal of solid state chemistry, 133, 117-121, 1997
Knotek, Otto
Lugscheider, Erich
Barimani, Cyrus
Möller, M.
New materials increase applications for brazing - P.I: Process considerations, P.II: Industrial heating
In: The journal of thermal technology, 1997, Dez.-Dez., 1997
Smith, R.
Lugscheider, Erich
Continous inductive hard-surface brazing of wear-resisting layers
In: Welding and cutting, 49 (6), E93-E95, 1997
Lugscheider, Erich
Schmoor, H.
Continious inductive hard-surface brazing of wear-resisting layers
In: Schweissen und Schneiden, 49 (6), E 93, 1997
Lugscheider, Erich
Schmoor, H.
Fügen und Beschichten in der Produktion der Zukunft
In: Der Praktiker, 49 (11), 516-516, 1997
Lugscheider, Erich
Kortenbruck, G.
von Hofe, D.
Reactive plasma spraying of coatings containing in situ synthezised titanium hard phases
In: International journal of refractory and hard metals : R & HM, 15 (5/6), 311-315, 1997
Lugscheider, Erich
Jungklaus, H.
Zhao, Lidong
Reymann, H.
Entwicklung und Anwendung von PVD-Schichten zur Verschleißverringerung von Druckgießformen
In: Giesserei : die Zeitschrift für Technik, Innovation und Management, 84 (23), 17-23, 1997
Lugscheider, Erich
Barimani, Cyrus
Guerreiro, S.
Tribological properties of B—C thin films deposited by magnetron-sputter-ion plating method
In: Surface & coatings technology, 91 (3), 167-173, 1997
[DOI: 10.1016/S0257-8972(96)03105-2]
Lugscheider, Erich
Knotek, Otto
Siry, C. W.
Arc PVD-coated cutting tools for modern machining applications
In: Thin solid films, 308/309, 1997
Lugscheider, Erich
Knotek, Otto
Barimani, Cyrus
Zimmermann, H.
Superstöchiometric PVD carbidic and carbonitridic coatings
In: Materials science & engineering / A, Structural materials: properties, microstructure and processing, 109, 1996
Knotek, O.
Lugscheider, Erich
Löffler, Frank
Bosserhoff, B.
Flammspritzen mit nachfolgendem Einschmelzen einer NiCrBSi-Legierung auf vergüteten Stählen
In: Schweissen und Schneiden, 48 (2), 116-125, 1996
Matthes, K.-J.
Weichbrodt, K.-H.
Lanzendörfer, G.
Lugscheider, E.
Nyland, A.
Sicking, R.
Mechanical properties of high-temperature brazed titanium materials
In: International journal of fatigue, 18 (6), 418-418, 1996
Lugscheider, Erich
Broich, U.
Weld, J.
Superstoichiometric PVD carbide coatings
In: Materials science & engineering / A, Structural materials: properties, microstructure and processing, 209 (1/2), 394-398, 1996
Lugscheider, Erich
Knotek, Otto
Löffler, Frank
Bosserhoff, B.
Schmitz, S.
Financiering binnen de EU van onderzoeksprogramma's toegespitst op duitsland
In: Materiaalkunde Nieuws, 1996 (4/April), 1996
Lugscheider, Erich
Krugers, J.-P.
Ladru, F.
Kinetic and microstructural aspects of the reaction layer at ceramic/metal braze joints
In: Journal of materials science : JMS, 31 (2), 445-452, 1996
Xu, R.
Lugscheider, Erich
Indacochea, J. E.
Tillmann, W.
Characterization of thermal sprayed bioactive coatings
In: Colloids and surfaces / B, Biointerfaces, 6 (1), 7 S., 1996
Lugscheider, Erich
Knepper, M.
Nyland, A.
PVD coatings for luricant-free tribological applications
In: Wear, 209, 101-105, 1996
Lugscheider, Erich
Knotek, Otto
Barimani, Cyrus
Möller, M.
Investigation of thermophysical properties of AIP coated cutting tools for dry machining
In: Surface & coatings technology, 86/87 (2), 803-808, 1996
Lugscheider, Erich
Geiler, H. D.
Lake, M.
Zimmermann, H.
Strength and microstructure of brazed cemented carbide and silicon nitride joints
In: Journal of materials processing technology, 58 (1), 13-23, 1996
[DOI: 10.1016/0924-0136(95)02103-5]
Lugscheider, Erich
Martens, L.
Tillmann, W.
Ziegler, G.
Modeling of the APS plasma spray process
In: Computational materials science, 7 (1/2), 109-114, 1996
Lugscheider, Erich
Barimani, Cyrus
Eckert, P.
Eritt, U.
Simulation of the deposition process in PVD-technology
In: Computational materials science, 7 (1/2), 154-158, 1996
[DOI: 10.1016/S0927-0256(96)00074-2]
Lugscheider, Erich
Knotek, Otto
Barimani, Cyrus
Eckert, P.
Hayn, G.
Sliding wear behaviour of thermally sprayed 75/25 Cr3C2/NiCr wear resistant coatings
In: Wear, 198, 251-266, 1996
[DOI: 10.1016/0043-1648(96)06983-9]
Mohanty, M.
Smith, R. W.
de Bonte, Marc
Celis, Jean-Pierre
Lugscheider, Erich
Comparison of the structure of PVD thin films deposited with different deposition energies
In: Surface & coatings technology, 86/87 (1), 177-183, 1996
Lugscheider, Erich
Barimani, Cyrus
Wolff, C.
Guerreiro, S.
Döpper, G.
Wirtschaftlichkeitsanalyse modernener Beschichtungsverfahren anhand ausgewählter Anwendungsbeispiele
In: Stahl, 1996 (4), 45-48, 1996
Lugscheider, Erich
May, J.
Wulfhorst, B.
Gries, T.
Bärwulf, Stephan
Bosserhoff, B.
Simulation von Strahlverschleiß
In: Metall, 50 (11), 713-722, 1996
Petersheim, J.
Elsing, Rainer
Effect of single impact damage on strength of alumina and zirconia-toughened alumina
In: Journal of materials science / Letters, 15, 1925-1926, 1996
Lugscheider, Erich
Huang, Xingija
Tu, Mingjing
Das Reib- und Verschleißverhalten von ungeschmierten Ti-Al-C-N-PVD-Schichten
In: Tribologie und Schmierungstechnik, 43 (2), 1996
Lugscheider, Erich
Löffler, Frank
Wolff, C.
Kriterien für die Auswahl von Beschichtungsverfahren
In: VDI-Z integrierte Produktion, 138 (1/2), 36-41, 1996
Nyland, A.
Kron, P. B.
Ellermeier, J.
Schierling, M.
Deposition of arc TiAlN coatings with pulsed bias
In: Surface & coatings technology, 76-77 (Part 2), 700-705, 1995
[DOI: 10.1016/02578-9729(68)00090-]
Lugscheider, E.
Knotek, O.
Loffler, F.
Barimani, C.
Guerreiro, S.
Zimmermann, H.
Einsatz von Zwischenschichten zum Abbau von Spannungen in aktivgelöteten Siliciumnitrid-Stahl-Verbindungen
In: Schweissen und Schneiden, 47 (2), 97-107, 1995
Lugscheider, Erich
Tillmann, W.
Maier, H. R.
Magin, Michael
Einsatz von PVD-Beschichtungen zur Minimierung von Kühlschmierstoffen bei der Zerspanung
In: VDI-Z integrierte Produktion / Special, 1995, 1995
Lugscheider, Erich
Löffler, Frank
Barimani, Cyrus
Zimmermann, H.
Eigenschaften hart- und hochtemperaturgelöteter Titanverbindungen
In: Schweissen und Schneiden, 47, 197-205, 1995
Lugscheider, Erich
Broich, U.
Steffens, H.-D.
Ashoff, D.
Design of wear resistant NiCr-TiC plasma sprayed coatings based on modifications in the carbide and the binder phase
In: Wear, 185, 1995
Economou, S.
de Bonte, Marc
Celis, Jean-Pierre
Smith, R. W.
Lugscheider, Erich
Wirtschaftlichkeitsanalyse neuer Beschichtungstechnologien
In: VDI-Z integrierte Produktion, 137 (7//8), 42-46, 1995
Lugscheider, Erich
Gries, Thomas
Wulfhorst, Burkhard
May, Johannes
Bosserhoff, Bert Hans
PVD-Beschichtungen contra Kühlschmierstoff-Verbrauch
In: VDI-Z integrierte Produktion / Special, 1995 (4), 38-42, 1995
Lugscheider, Erich
Löffler, Frank
Barimani, Cyrus
Zimmermann, H.
Plasmaspritzen von Titanhartstoffen : Neue Möglichkeiten zum Verschleißschutz
In: Schweissen und Schneiden, 47, 822-831, 1995
Lugscheider, Erich
Jungklaus, H.
Wielage, B.
Henker, A.
Heat resistant active brazing of silicon-nitride : P. 1: Mechanical evaluation of braze joints
In: Welding journal, 74, 1995
Lugscheider, Erich
Tillmann, W.
Schlimbach, K.
Manter, C.
Indacochea, J. E.
Thick thermal barrier coatings for Diesel engines
In: Surface engineering, 11 (4), 1995
Lugscheider, Erich
Kvernes, I.
Thermal sprayed aluminium-silicon alloy coatings
In: Materials and manufacturing processes, 10, 837-841, 1995
Lugscheider, Erich
Jokiel, P.
Feldhege, M.
Tribological behaviour of TiC/TaC-reinforced cermet plasma sprayed coatings tested against sapphire
In: Wear, 185 (1/2), 93-110, 1995
[DOI: 10.1016/0043-1648(95)06597-0]
Economou, S.
de Bonte, Marc
Celis, Jean-Pierre
Roos, J. R.
Smith, R. W.
Lugscheider, Erich
Valencic, A.
Arc-evaporation of multicomponent MCrAlY cathodes
In: Surface & coatings technology, 74/75, 118-122, 1995
Lugscheider, Erich
Knotek, Otto
Löffler, F.
Beele, W.
Barimani, Cyrus
Deposition of arc-TiAIN coatings with pulsed bias
In: Surface & coatings technology, 76/77, 700-705, 1995
Lugscheider, Erich
Knotek, Otto
Löffler, Frank
Barimani, Cyrus
Guerreiro, S.
Zimmermann, H.
Steigerung der Warmfestigkeit der Bindephase von Cermets
In: Metall, 49, 326-336, 1995
Grewe, H.
Kolaska, H.
Entwicklung von hochtemperaturbeständigen Aktivlötverbindungen aus Nichtoxidkeramik
In: Metall, 48 (1), 27-33, 1994
Lugscheider, Erich
Tillmann, Walter
Weise, W.
The wear behaviour of heat-treated PVD coatings
In: Surface & coatings technology, 68, 199-202, 1994
[DOI: 10.1016/0257-8972(94)90160-0]
Knotek, O.
Löffler, F.
Wolff, C.
Wolkers, L.
Behaviour of CVD and PVD coatings under impact load
In: Surface & coatings technology, 68/69, 253-258, 1994
[DOI: 10.1016/0257-8972(94)90170-8]
Knotek, O.
Lugscheider, E.
Löffler, F.
Schrey, A.
Bosserhoff, B.
Plasma spraying of high-nitrogen-bearing steels for wear-resistant coatings and structural applications
In: Journal of materials engineering and performance, 3 (4), 476-483, 1994
[DOI: 10.1007/BF02645313]
Khatri, S.
Smith, R.
Jokiel, P.
Lugscheider, E.
Bohley, M.
TiO2 - PVD. Sputtertemperatur und Haftfestigkeit
In: Metalloberfläche : mo, 48, 40-45, 1994
Pyun, S.-I.
Yoon, Y.-G.
Hyun, S.-M.
Lugscheider, E.
Mathesius, R.
Verbesserung der Eigenschaften von Hartlegierungen durch auftraggeschweißte carbidische Verbundpulver
In: Schweissen und Schneiden, 46, 109-114, 1994
Lugscheider, E.
Ait-Mekideche, Azedine
Melzer, A.
Phase-relations in the c-cr-fe system in the vicinity of the (liquid+bcc+m23c6+m7c3) invariant equilibrium - experimental determinations and thermodynamic modeling
In: Zeitschrift für Metallkunde, 85 (5), 359-364, 1994
Kowalski, M.
Spencer, P. J.
Granat, K.
Drzeniek, H.
Lugscheider, E.
Subsequent sealing of thermally sprayed coatings to increase corrosion resistance
In: Surface engineering, 10, 46-51, 1994
Lugscheider, E.
Jokiel, P.
Messerschmidt, V.
Beckschulte, G.
Technologische Eigenschaften von Breitspaltlötverbindungen an Rohren
In: Schweissen und Schneiden, 46, 274-276, 1994
Lugscheider, E.
Schmoor, H.
Einsetzbarkeit gelöteter Chrom-Nickel-Stähle in Wässern
In: Der Praktiker, 46, 228-230, 1994
Brandl, W.
Steffens, H.-D.
Rukzinski, D.
Podleschny, R.
Lugscheider, E.
Minarski, P.
Neuartige Schweißzusatzwerkstoffe auf Fe-W-Ti-C-Basis gegen mineralischen Abrasivverschleiß
In: Braunkohle, Tagebautechnik - Neue Bergbautechnik, 45, 24-28, 1994
Lugscheider, Erich
Reymann, H.
Kupferbasis-Reaktionslote. Ein Lösungsweg zum Löten poröser Sinterstähle
In: Schweissen und Schneiden, 46, 425-429, 1994
Lugscheider, E.
Tillmann, W.
Feng, M. E. Z.
Zur Ausbildung von Reaktionsschichten bei aktivgelöteten nichtoxidischen Ingenieurkeramiken. T. 1: Grundlagen und Wechselwirkung zwischen Aktivmetallen und Siliciumnitrid
In: VTE : Aufbau- und Verbindungstechnik in der Elektronik, 1994, 156-162, 1994
Tillmann, W.
Lugscheider, E.
Gale, W. F.
Zur Ausbildung von Reaktionsschichten bei aktivgelöteten nichtoxidischen Ingenieurkeramiken. T. 2: Wechselwirkung zwischen Aktivmetallen und Siliciumcarbid sowie Aluminiumnitrid
In: VTE : Aufbau- und Verbindungstechnik in der Elektronik, 1994, 210-212, 1994
Tillmann, W.
Lugscheider, E.
Gale, W. F.
Möglichkeiten des stoffschlüssigen Fügens metallischer Verbundwerkstoffe. Eine Übersicht
In: Schweissen und Schneiden, 46, 543-549, 1994
Tillmann, W.
Lugscheider, E.
Cytotoxicity investigations of plasma sprayed calcium phosphate coatings
In: Journal of materials science / Materials in medicine, 5, 371-375, 1994
[DOI: 10.1007/BF00058966]
Lugscheider, E.
Knepper, M.
Heimberg, B.
Dekker, A.
Kirkpatrick, C. J.
Pulvermetallurgie im Wettbewerb
In: Met, 48, 899, 1994
Lugscheider, E.
Deiser, C.
Hochtemperatureigenschaften von MCrAlY(Ti,Hf) beschichtetem Ventilstahl X 45 CrSi 9 3 bei 600 und 700°C
In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 24 (11), 397-403, 1993
[DOI: 10.1002/mawe.19930241110]
Lugscheider, Erich
Müller, U.
Holdinghausen, A.
Performance behaviour of physical-vapour-deposition-coated cermets in interrupted-cut machining
In: Surface & coatings technology, 62 (1/3), 669-673, 1993
[DOI: 10.1016/0257-8972(93)90316-G]
Knotek, O.
Löffler, F.
Krämer, G.
Interessante Anwendungen für das Hochtemperaturlöten
In: Jahrbuch Schweißtechnik, 1994, 173-178, 1993
Lugscheider, E.
Tillmann, W.
Schmoor, H.
Plasmaspritzen - Verfahren, Anwendungen, Entwicklungen
In: Metall, 47, 230-236, 1993
Lugscheider, E.
Jokiel, P.
Werkstoff- und Prozeßentwicklung in der Beschichtungstechnik
In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 5 (3), 42-45, 1993
Lugscheider, E.
Westermann, U.
Evaluation of d.c.-plasma jet chemical vapour deposition for diamond coatings on tungsten carbide based cutting plates
In: Diamond and related materials, 2 (12), 1464-1466, 1993
[DOI: 10.1016/0925-9635(93)90013-R]
Lugscheider, E.
Müller, U.
Zuverlässiges belastbares Fügeverfahren für Motorenbau und Energietechnik
In: Handelsblatt : Deutschlands Wirtschafts- und Finanzzeitung, 63 (31.3.1993), 31, 1993
Lugscheider, E.
Tillmann, W.
Weise, W.
Methods for brazing ceramic and metal-ceramic joints
In: Materials and manufacturing processes, 8, 219-238, 1993
Lugscheider, E.
Tillmann, W.
Braze coat process combines with induction heating for deposition of wear-resistant materials
In: Welding journal, 72 (5), 55-59, 1993
Lugscheider, E.
Gundlfinger, K.
Schmoor, H.
Zukunftsweisende Tendenzen im Thermischen Spritzen
In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 5 (5/6), 70-72, 1993
Lugscheider, E.
Jokiel, P.
Titandisilizid - ein korrosionsbeständiger Hochtemperatur-Werkstoff mit metallischen Eigenschaften
In: Metall, 47, 741-745, 1993
Westermann, U.
Lugscheider, E.
Wonka, J.
Verarbeitung Cr3C2-verstärkter Nickelhartlegierungen durch das autogene Flammspritzen
In: Schweissen und Schneiden, 45, 494-498, 1993
Lugscheider, E.
Jokiel, P.
Reimann, H.
Heinrich, P.
Applying Cr3C2-reinforced nickel-based hard alloys by oxyacetylene flame spraying
In: Welding and cutting, 1993 (9), E163- E166, 1993
Lugscheider, E.
Jokiel, P.
Reimann, H.
Heinrich, P.
Verarbeitung wolframcarbidverstärkter Nickelhartlegierungen durch Flammspritzen
In: Schweissen und Schneiden, 45, 601-604, 1993
Lugscheider, E.
Jokiel, P.
Karduck, P.
Reimann, H.
Heinrich, P.
Arc deposition of Ti-C and Ti-C-N using acetylene as a reactive gas
In: Vacuum, 43 (5/7), 645-648, 1992
[DOI: 10.1016/0042-207X(92)90098-H]
Knotek, Otto
Löffler, Frank
Krämer, G.
Reproducible arc-PVD process management under various reactive gases
In: Vacuum, 43 (5/7), 567-571, 1992
[DOI: 10.1016/0042-207X(92)90079-C]
Knotek, Otto
Löffler, Frank
Krämer, G.
Stössel, C.
Multicomponent and multilayer physically vapor-deposited coatings for cutting tools
In: Surface & coatings technology, 54 (1/3), 241-248, 1992
[DOI: 10.1016/0257-8972(92)90169-B]
Knotek, Otto
Löffler, Frank
Kramer, G.
Thermisches Spritzen
In: Keramische Zeitschrift, 44 (Beil.), 1-4, 1992
Eschnauer, H.
Lugscheider, E.
Müller, U.
Weber, T.
Entwicklung hochvakuumdichter Oxidkeramik-Metall-Lötverbindungen
In: Schweissen und Schneiden, 44, 92-96, 1992
Lugscheider, E.
Boretius, M.
Surface engineering of Diesel engine parts - new technological achievements in powders and coating microstructures
In: Powder metallurgy international : PMI, 24, 7-13, 1992
Kvernes, I.
Lugscheider, E.
Zusatzwerkstoffe zum Metall-Inertgasauftragschweißen
In: Schweissen und Schneiden, 44, 138-143, 1992
Lugscheider, E.
Deppe, E.
Ambroziak, Andrej
Melzer, A.
Weld filler materials for metal-arc inert gas surface welding
In: Welding and cutting, 1992 (3), E 50-E 53, 1992
Lugscheider, E.
Deppe, E.
Ambroziak, Andrej
Melzer, A.
Beschichtungen durch Vakuumplasmaspritzen
In: Technica : die Fachzeitschrift für die Maschinen-, Elektro- und Metallindustrie, 41 (9), 19-22, 1992
Lugscheider, E.
Born, K.
Modelling of temperature gradients and stress-strain distributions during the plasma spraying process
In: Powder metallurgy international : PMI, 24, 240-245, 1992
Borgerding, B.
Sölter, H.-J.
Lugscheider, E.
Simhan, K.
Kristalline Diamantschichten auf Schneidwerkzeugen
In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 4 (7/8), 42-44, 1992
Lugscheider, E.
Müller, U.
High-speed temperature measurement for on-line process control and quality assurance during plasma-spraying
In: Powder metallurgy international : PMI, 24, 169-175, 1992
Sölter, H.-J.
Müller, U.
Lugscheider, E.
Optimization of spraying process and laser treatment of CoNiCrA1Y
In: Journal of thermal spray technology : JTST, 1, 239-248, 1992
Lugscheider, E.
Hofmann, D.
Nicoll, A. R.
Hochvakuumdichte Keramik-Metall-Lötverbindungen
In: Metall, 46, 802-805, 1992
Lugscheider, E.
Boretius, M.
Comparison of properties of coatings produced by laser cladding and conventional methods
In: Journal of materials science & technology : JMST, 8, 657-665, 1992
Oberländer, B. C.
Lugscheider, E.
Fügen von Keramik bei hohen Betriebstemperaturen
In: Werkstoff und Innovation, 5 (5/6), 44-48, 1992
Lugscheider, E.
Tillmann, W.
Production of spherical powders - the first step for optimized thermal-sprayed apatite coatings
In: Journal of thermal spray technology : JTST, 1, 215-221, 1992
Lugscheider, E.
Knepper, M.
Gross, K. A.
Underwater plasma processing of stabilized zirconia for thermal barrier coatings
In: Journal of thermal spray technology : JTST, 1, 49-55, 1992
Lugscheider, E.
Rass, I.
Metallographische Präparation plasmagespritzter Borcarbid-Schichten
In: Praktische Metallographie = Practical metallography, 23, 501-512, 1992
Lugscheider, E.
Koch, D.
Limbach, R.
The development of high vacuum-tight oxide ceramic-metal brazed joints
In: Welding and cutting, 1992 (2), E 37-E 40, 1992
Lugscheider, E.
Boretius, M.
Properties of arc-evaporated crn and (cr, al)n coatings
In: Surface & coatings technology, 45 (1/3), 53-58, 1991
[DOI: 10.1016/0257-8972(91)90205-B]
Knotek, Otto
Löffler, Frank
Scholl, H. J.
On the origin of compressive stress in PVD coatings : an explicative model
In: Surface & coatings technology, 46 (3), 265-274, 1991
[DOI: 10.1016/0257-8972(91)90169-W]
Knotek, Otto
Elsing, Rainer
Krämer, G.
Jungblut, F.
Ti(c,n) coatings using the arc process
In: Surface & coatings technology, 46 (1), 39-46, 1991
[DOI: 10.1016/0257-8972(91)90148-P]
Ertürk, E.
Knotek, Otto
Burgmer, W.
Prengel, H.-G.
Heuvel, H. J.
Dederichs, H. G.
Stossel, C.
Magnetron-sputtered superhard coatings within the system Ti-B-C-N
In: Vacuum, 41 (7/9), 2184-2186, 1990
[DOI: 10.1016/0042-207X(90)94220-K]
Knotek, O.
Jungblut, F.
Breidenbach, R.
Untersuchungen zur Korrosionsbeständigkeit hochtemperaturgelöteter Werkstoffe in Trinkwasser
In: Schweissen und Schneiden, 41, 590-595, 1989
Lugscheider, E.
Minarski, P.
Werkstoffkundliche Untersuchungen zum Löten verschiedener orthodontischer Drähte
In: Journal of orofacial orthopedics, 50, 506-517, 1989
Hannemann, M.
Minarski, P.
Lugscheider, E.
Diedrich, P.
Entwicklung und Optimierung von Eisen-Chrom-Bor-Kohlenstoff-Legierungen für das Metallichtbogenschweißen von Hartauftragungen mit Fülldrahtelektroden
In: Schweissen und Schneiden, 41, 661-666, 1989
Drzeniek, H.
Granat, K.
Li, Z.
Lugscheider, E.
Erosionsverhalten von Nickelbasisloten beim Hochtemperaturlöten
In: Schweissen und Schneiden, 41, 342-345, 1989
Lugscheider, E.
Cosack, T.
Oberflächenvorbehandlung schwer benetzbarer metallischer Werkstoffe
In: Schweissen und Schneiden, 41, 221-225, 1989
Lugscheider, E.
Minarski, P.
Unterwasserplasmaspritzen - eine neue Verfahrensvariante
In: Schweissen und Schneiden, 41, 547-550, 1989
Lugscheider, E.
Bugsel, B.
Erosionsverhalten von Nickelbasisloten beim Hochtemperaturlöten
In: Schweissen und Schneiden, 41, 342-345, 1989
Lugscheider, E.
Cosack, T.
Laserunterstützte Beschichtungstechnologie - Verwirklichung neuer Werkstoffzustände mit dem Hochleistungslaser
In: Schweissen und Schneiden, 40 (9), 1988
Lugscheider, E.
Fügen von Hochleistungskeramik untereinander und mit Metall
In: Technische Mitteilungen : TM, 80 (4), 1987
Lugscheider, Erich
Krappitz, Harald
Boretius, M.
Stand und Entwicklungstendenzen beim Plasmaspritzen
In: Elektrowärme international : ewi, 45, B 190-B 195, 1987
Lugscheider, Erich
Weber, Thomas
Überwältigendes Anwendungspotential. Plasmaspritzen von Verschleiss- schutzschichten
In: Industrie-Anzeiger, 109 (83), 1987
Lugscheider, Erich