Fachzeitschriftenartikel
Quelle | Autor(en) |
---|---|
Enhanced adhesion and thermal stability of thick (Al,Cr)2O3 coatings on hot work steel In: Surface and coatings technology, 476, Paper Nr. 130179, 11 Seiten, 2024 [DOI: 10.1016/j.surfcoat.2023.130179] | Bobzin, Kirsten Kalscheuer, Christian Möbius, Max Philip Hassanzadegan Aghdam, Parisa (Corresponding author) |
Design and characterization of novel iron-based amorphous brazing foils based on thermodynamic predictions In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 54 (11), 1340-1349, 2023 [DOI: 10.1002/mawe.202300031] | Bobzin, Kirsten Heinemann, Hendrik Erck, Marvin Stryzhyboroda, Oleg Vinke, Sophie (Corresponding author) |
Substrate dependent cracking behavior of CrAlN coatings - A nanoindentation based investigation In: Vakuum in Forschung und Praxis, 7 Seiten, 2023 [DOI: 10.1002/vipr.202300809] | Bobzin, Kirsten Kalscheuer, Christian Tayyab, Muhammad (Corresponding author) |
Investigation of the Influence of Triboactive CrAlMoN Coating on the Joint Wear of Grease-Lubricated Roller Chains In: Tribology transactions, [1]-12, 2023 [DOI: 10.1080/10402004.2023.2264908] | Rank, Martin (Corresponding author) Oehler, Manuel Koch, Oliver Bobzin, Kirsten Kalscheuer, Christian Möbius, Max Philip |
Triboactive CrAlN+MoWS coatings deposited by pulsed arc PVD In: Surface and coatings technology, 475, Paper Nr. 130178, 10 Seiten, 2023 [DOI: 10.1016/j.surfcoat.2023.130178] | Bobzin, Kirsten Kalscheuer, Christian Möbius, Max Philip (Corresponding author) |
Impedance Measurement and Demonstrator Tests of Developed Thermally Sprayed and Sealed Coating Systems for Bearing Applications In: Advanced engineering materials, 2301086, 2023 [DOI: 10.1002/adem.202301086] | Bobzin, Kirsten Heinemann, Hendrik Olesch, Elisa (Corresponding author) Hosenfeldt, Tim Bagcivan, Nazlim Öte, Mehmet Müller, Björn Kunde, Carsten |
Effect of heat treatment on the structure, fracture toughness and oxidation behavior of a silicon coating by atmospheric plasma spraying In: Surface and coatings technology, 472, Paper Nr. 129965, 7 Seiten, 2023 [DOI: 10.1016/j.surfcoat.2023.129965] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Heinemann, Hendrik Burbaum, Elisa Li, Shan |
Thermisch gespritzte Fe-TiC-Beschichtungen als wirtschaftlicher und verschleißbeständiger Hartchromersatz In: WOMag, 12, 20-21, 2023 | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Heinemann, Hendrik Burbaum, Elisa |
Thermische Ausdehnung von Hochentropie-Legierungen für Mehrlagenheizsysteme In: Thermal spray bulletin, 16 (2), 100-106, 2023 | Bobzin, Kirsten Heinemann, Hendrik Erck, Marvin Schacht, Andreas (Corresponding author) |
Thermisch gespritzte Beschichtungen als Lösung zum Fügen von Stahl/Al-Verbundgussbauteilen In: Thermal spray bulletin, 16 (2), 108-114, 2023 | Bobzin, Kirsten Heinemann, Hendrik Erck, Marvin (Corresponding author) Körner, Johannes |
Novel Fe-Based Amorphous Brazing Foils in the Quinary System Fe-Ni-Cr-Si-B In: Advanced engineering materials, 2300403, 2023 [DOI: 10.1002/adem.202300403] | Bobzin, Kirsten Heinemann, Hendrik Erck, Marvin Stryzhyboroda, Oleg Vinke, Sophie (Corresponding author) |
Effect of CrAIN coating properties on impact fatigue of tool steel In: Surface and coatings technology, 471, Paper Nr. 129869, 12 Seiten, 2023 [DOI: 10.1016/j.surfcoat.2023.129869] | Bobzin, Kirsten Kalscheuer, Christian Tayyab, Muhammad (Corresponding author) |
Oxidation and wear behavior of CrAlMoN with varied Mo-content for cutting Ti6Al4V In: Production engineering, 11 Seiten, 2023 [DOI: 10.1007/s11740-023-01218-2] | Bobzin, Kirsten Kalscheuer, Christian Stachowski, Nina Isabell Inge (Corresponding author) Dege, Jan Hintze, Wolfgang Möller, Carsten Ploog, Petter |
Microstructural Modification by Redesigning the Chemical Composition of Ni 620 Filler Metal In: Advanced engineering materials, 2300318, 2023 [DOI: 10.1002/adem.202300318] | Bobzin, Kirsten Heinemann, Hendrik Erck, Marvin (Corresponding author) |
Machine learning based model for plasma prediction in high power pulsed magnetron sputtering processes In: Thin solid films, 777, 139903, 8 Seiten, 2023 [DOI: 10.1016/j.tsf.2023.139903] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Janowitz, Julia (Corresponding author) |
Prediction of OES intensity ratios based on coating unit data in HPPMS processes by ANN In: Journal of physics / D, 56 (36), 364001, 9 Seiten, 2023 [DOI: 10.1088/1361-6463/acd793] | Bobzin, Kirsten Kalscheuer, Christian Möbius, Max Philip Schulze, Christoph Franz Robert (Corresponding author) |
Influence of Ti inoculation on the wetting behaviour and microstructure of various Ni-based brazing alloys in combination with X5CrNi18-10 In: Welding and cutting, 22 (1), 16-22, 2023 [DOI: 10.53192/WAC202301WAC16] | Bobzin, Kirsten Heinemann, Hendrik Erck, Marvin Vinke, Sophie (Corresponding author) |
Correction to: Development of an Expert System for Prediction of Deposition Efficiency in Plasma Spraying In: Journal of thermal spray technology, 32 (6), 1908-1908, 2023 [DOI: 10.1007/s11666-023-01602-5] | Bobzin, Kirsten Heinemann, Hendrik Dokhanchi, Seyed Ruhollah (Corresponding author) |
Investigation of novel nano-carbide wc/cocr coatings applied by hvaf In: Journal of thermal spray technology : JTST, 32, 1772-1779, 2023 [DOI: 10.1007/s11666-023-01607-0] | Bobzin, Kirsten Wietheger, Wolfgang Burbaum, Elisa Johann, Lukas Martin (Corresponding author) Rempe, L. J. Matikainen, V. Kanerva, U. Karhu, M. Lagerbom, J. Kaunisto, K. Lartigue, J.-F. |
Triboactive coatings for wear and friction reduction in chain drives In: Tribology international, 185, 108562, 2023 [DOI: 10.1016/j.triboint.2023.108562] | Bobzin, Kirsten Kalscheuer, Christian Möbius, Max Philip (Corresponding author) Rank, Martin Oehler, Manuel Koch, Oliver |
Local approaches for the fatigue strength assessment of brazed joints made of X5CrNi18-10 and Cu 110 considering brazed seam quality and failure behavior In: Welding in the world, 67 (7), 1833-1852, 2023 [DOI: 10.1007/s40194-023-01524-4] | Jöckel, A. (Corresponding author) Baumgartner, J. Tillmann, W. Bültena, J. Bobzin, Kirsten Heinemann, Hendrik Erck, Marvin |
Numerical investigation of the effect of a nozzle extension on the plasma jet in multi-arc plasma spraying In: Journal of thermal spray technology : JTST, 32, 1856-1863, 2023 [DOI: 10.1007/s11666-023-01588-0] | Bobzin, Kirsten Heinemann, Hendrik Dokhanchi, Seyed Ruhollah (Corresponding author) |
Schichtentwicklung für die potenzielle Anwendung in PEM-Wasserelektrolyse In: Thermal spray bulletin, 16 (1), 42-48, 2023 | Bobzin, Kirsten Zhao, Lidong Heinemann, Hendrik Burbaum, Elisa Radermacher, Katja |
Tribological performance of (Cr,Al)N+Mo:W:Sg in fluid-free friction regime In: Wear : an international journal on the science and technology of friction, lubrication and wear, 512/513, 204557, 2022 [DOI: 10.1016/j.wear.2022.204557] | Bobzin, Kirsten Kalscheuer, Christian Thiex, Matthias (Corresponding author) |
Influence of the etching process on the coating performance in dry tribological contacts In: Journal of vacuum science & technology : JVST / A, 41 (3), 033104, 13 Seiten, 2023 [DOI: 10.1116/6.0002363] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Schulze, Christoph Franz Robert (Corresponding author) |
Vorteile durch gepulste Verdampfung In: Magazin für Oberflächentechnik, 77 (1/2), 36-38, 2023 | Bobzin, Kirsten Kalscheuer, Christian Möbius, Max Philip (Corresponding author) Eichenhofer, Gerhard |
Correlation Between Process Parameters and Particle In-flight Behavior in AC-HVAF In: Journal of thermal spray technology, 32 (2/3), 559-567, 2023 [DOI: 10.1007/s11666-023-01543-z] | Bobzin, Kirsten Heinemann, Hendrik Jasutyn, Kevin (Corresponding author) |
Replication of Particle Trajectories in the Plasma Jet with Two Consecutive Residual Neural Networks In: Journal of thermal spray technology, 32 (5), 1447-1464, 2023 [DOI: 10.1007/s11666-023-01533-1] | Bobzin, Kirsten Heinemann, Hendrik Dokhanchi, Seyed Ruhollah (Corresponding author) Rom, Christian Michael |
Calcia-magnesia-alumino-silicate-induced degradation of (Gd0.9Yb0.1)2Zr2O7 thermal barrier coatings prepared by plasma spray-physical vapor deposition (PS-PVD) In: Surface and coatings technology, 454, 129179, 2022 [DOI: 10.1016/j.surfcoat.2022.129179] | Li, Shan Chen, Wenbo Zhao, Lidong Guo, Hongbo (Corresponding author) |
Development of Near Net Shaped Coatings for Reduced Postprocessing Costs in Valves In: Journal of thermal spray technology, 32 (2/3), 681-692, 2023 [DOI: 10.1007/s11666-023-01539-9] | Bobzin, Kirsten Heinemann, Hendrik Burbaum, Elisa Schulz, Marvin (Corresponding author) |
Modeling the Droplet Impact on the Substrate with Surface Preparation in Thermal Spraying with SPH In: Journal of thermal spray technology : JTST, 32 (2/3), 599-608, 2023 [DOI: 10.1007/s11666-023-01534-0] | Bobzin, Kirsten Heinemann, Hendrik Jasutyn, Kevin (Corresponding author) Jeske, Stefan Rhys Bender, Jan Stephen Warkentin, Sergej Mokrov, Oleg Sharma, Rahul Reisgen, Uwe |
3D deformation modeling of CrAlN coated tool steel compound during nanoindentation In: Surface and coatings technology, 453, 129148, 2023 [DOI: 10.1016/j.surfcoat.2022.129148] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Schmauder, Siegfried Guski, Vinzenz Verestek, Wolfgang Tayyab, Muhammad (Corresponding author) |
An Approach to Synthesize Thick α- and γ-Al2O3 Coatings by High-Speed Physical Vapor Deposition In: Advanced engineering materials, 25 (4), 2201195, 2022 [DOI: 10.1002/adem.202201195] | Bobzin, Kirsten Kalscheuer, Christian Hassanzadegan Aghdam, Parisa (Corresponding author) |
Development of an Expert System for Prediction of Deposition Efficiency in Plasma Spraying In: Journal of thermal spray technology : JTST, 32 (2/3), 643-656, 2022 [DOI: 10.1007/s11666-022-01494-x] | Bobzin, Kirsten Heinemann, Hendrik Dokhanchi, Seyed Ruhollah (Corresponding author) |
DLC-Coated Thermoplastics : Tribological Analyses Under Dry and Lubricated Sliding Conditions In: Tribology letters, 71 (1), 2, 2022 [DOI: 10.1007/s11249-022-01663-7] | Bobzin, Kirsten Kalscheuer, Christian Thiex, Matthias (Corresponding author) Sperka, P. Hartl, M. Reitschuster, S. Maier, E. Lohner, T. Stahl, K. |
Experimental study and thermodynamic modelling of the ternary system Fe-Ni-Si with re-modelling of the constituent binary systems In: Journal of alloys and compounds : JAL, 935 (2), 168118, 2022 [DOI: 10.1016/j.jallcom.2022.168118] | Witusiewicz, Viktor T. (Corresponding author) Stryzhyboroda, Oleg Vinke, Sophie Bobzin, Kirsten Hecht, Ulrike |
Design and investigation of an FeSiBCNb metallic glass with low electrical and thermal conductivity In: Journal of alloys and compounds : JAL, 993, 167749, 2022 [DOI: 10.1016/j.jallcom.2022.167749] | Bobzin, Kirsten Wietheger, Wolfgang Burbaum, Elisa Johann, Lukas Martin (Corresponding author) Glushych, Viktor |
Self-lubricating CrAlMoN high performance tool coatings for machining of TiAl6V4 In: Production engineering, 17 (3/4), 437-444, 2022 [DOI: 10.1007/s11740-022-01161-8] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Stachowski, Nina Isabell Inge (Corresponding author) Hintze, W. Möller, C. Ploog, P. |
Neues aus dem Institut für Oberflächentechnik der RWTH Aachen In: Thermal spray bulletin, 15 (1), 8-10, 2022 | Bobzin, Kirsten Wietheger, Wolfgang |
Altbewährt aber noch lange nicht erschöpft In: Magazin für Oberflächentechnik, 75 (3), 42-43, 2022 | Bobzin, Kirsten |
DLC‑Coated Thermoplastics: Tribological Analyses under Lubricated Rolling‑Sliding Conditions In: Tribology letters, 70 (4), 121, 2022 [DOI: 10.1007/s11249-022-01664-6] | Reitschuster, S. (Corresponding author) Maier, E. Lohner, T. Stahl, K. Bobzin, Kirsten Kalscheuer, Christian Thiex, Matthias Sperka, P. Hartl, M. |
Oxidation stability of chromium aluminum oxynitride hard coatings In: Surface and coatings technology, 449, 128927, 2022 [DOI: 10.1016/j.surfcoat.2022.128927] | Bobzin, Kirsten Kalscheuer, Christian Grundmeier, Guido De los Arcos, Teresa Kollmann, Sabrina Carlet, Marco (Corresponding author) |
Thermisch gespritzte Beschichtungen für Trockengleitlager In: Thermal spray bulletin, 15 (2), 104-111, 2022 [DOI: 10.53192/TSB202202104] | Bobzin, Kirsten Heinemann, Hendrik Burbaum, Elisa Schulz, Marvin (Corresponding author) |
Influence of the atmospheric plasma spraying parameters on the coating structure and the deposition efficiency of silicon powder In: The international journal of advanced manufacturing technology, 123, 35-47, 2022 [DOI: 10.1007/s00170-022-10008-6] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Heinemann, Hendrik Burbaum, Elisa |
Bewertung thermisch gespritzter Oxidkeramiken für die Isolationsanwendungen in der Elektromobilität In: Thermal spray bulletin, 15 (2), 90-96, 2022 [DOI: 10.53192/TSB20220286] | Bobzin, Kirsten Heinemann, Hendrik Burbaum, Elisa |
Kalorimetrische Analyse von ternären Fe-Ni-Si-Legierungen für neuartige Lötfolien auf Fe-Basis In: Schweissen und Schneiden, 74 (6), 368-373, 2022 | Bobzin, Kirsten Heinemann, Hendrik Hebing, Julian Stryzhyboroda, Oleg Vinke, Sophie |
Adaptive (Cr,Al)N+Mo:Sg Coating for Highly‐Stressed Contacts under Dry Rolling‐Sliding Conditions In: Tribology international, 174, 107761, 2022 [DOI: 10.1016/j.triboint.2022.107761] | Bobzin, Kirsten Kalscheuer, Christian Thiex, Matthias (Corresponding author) Stahl, K. Lohner, T. Maier, E. Yilmaz, M. |
High-Velocity Arc Spraying of Fe-based Metallic Glasses with High Si Content In: Journal of thermal spray technology : JTST, 31 (7), 2219-2228, 2022 [DOI: 10.1007/s11666-022-01433-w] | Bobzin, Kirsten Wietheger, Wolfgang Burbaum, Elisa Johann, Lukas Martin (Corresponding author) |
From cathode to substrate : Plasma diagnostics on high power pulsed magnetron sputtering deposition of titanium nitride In: Thin solid films, 755, 139331, 2022 [DOI: 10.1016/j.tsf.2022.139331] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Schulze, Christoph Franz Robert (Corresponding author) |
Influence of brazing process and gap size on the fatigue strength of shear and peel specimen In: Welding in the world, 66 (10), 1941-1955, 2022 [DOI: 10.1007/s40194-022-01304-6] | Jöckel, A. (Corresponding author) Baumgartner, J. Tillmann, W. Bültena, J. Bobzin, Kirsten Heinemann, Hendrik Hebing, Julian Erck, Marvin |
Development of a novel green coating process with laser In: Scientific reports, 12 (1), 6314, 2022 [DOI: 10.1038/s41598-022-10351-4] | Zhong, Chongliang (Corresponding author) Backes, Gerhard Johann, Lukas Martin Kittel, Jochen Schopphoven, Thomas Küppers, Wolfgang |
Entwicklung dichter Si-Beschichtungen mittels Atmosphärischen Plasmaspritzens In: Thermal spray bulletin, 15 (1), 34-40, 2022 [DOI: 10.53192/TSB20220126] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Wietheger, Wolfgang Burbaum, Elisa |
Low-Temperature Physical Vapor Deposition TiAlCrSiN Coated High-Speed Steel : Comparison Between Shot-Peened and Polished Substrate Condition In: Advanced engineering materials, 24 (9), 2200099, 2022 [DOI: 10.1002/adem.202200099] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Hoffmann, Dennis Christopher (Corresponding author) Bergs, Thomas Uhlmann, Lars Heinz |
Hybrid reactive sputtering of transition metal aluminum oxynitrides In: Thin solid films, 742, 139028, 2021 [DOI: 10.1016/j.tsf.2021.139028] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco (Corresponding author) Schulze, Christoph Franz Robert |
Schneller und günstiger zum Ziel In: Magazin für Oberflächentechnik : mo, 76 (1/2), 32-35, 2022 | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Schulze, Christoph Franz Robert |
Comparison of Ceramic Insulation Coatings via Impedance Spectroscopy In: Journal of thermal spray technology : JTST, 31 (5), 1556-1567, 2022 [DOI: 10.1007/s11666-022-01395-z] | Bobzin, Kirsten Wietheger, Wolfgang Burbaum, Elisa (Corresponding author) Hosenfeldt, Tim Bagcivan, Nazlim Öte, Mehmet Müller, Björn Kunde, Carsten Elsner, Anna-Lena |
Triboaktive Beschichtungen : Neue Entwicklungen für fluidfrei geschmierte Stirnradverzahnungen In: Vakuum in Forschung und Praxis, 34 (1), 18-23, 2022 [DOI: 10.1002/vipr.202200771] | Bobzin, Kirsten Kalscheuer, Christian Thiex, Matthias (Corresponding author) |
Application and benchmark of SPH for modeling the impact in thermal spraying In: Computational particle mechanics : CPM, 9, 1137-1152, 2022 [DOI: 10.1007/s40571-022-00459-9] | Jeske, Stefan Rhys (Corresponding author) Bender, Jan Stephen Bobzin, Kirsten Heinemann, Hendrik Jasutyn, Kevin Simon, Marek Sebastian Mokrov, Oleg Sharma, Rahul Reisgen, Uwe |
Capturing the Influence of Jet Fluctuations on Particles in Plasma Spraying In: Journal of thermal spray technology, 31 (1/2), 59-69, 2022 [DOI: 10.1007/s11666-021-01307-7] | Bobzin, Kirsten Heinemann, Hendrik (Corresponding author) O'Brien, Andreas |
CrN/AlN nanolaminates: Architecture, residual stresses, and cracking behavior In: Journal of vacuum science & technology / A, 40 (1), 013414, 2021 [DOI: 10.1116/6.0001462] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Maier, H. J. Heidenblut, T. Besserer, H.-B. Kahra, C. Janowitz, Julia (Corresponding author) |
Impact Resistance and Properties of (Cr,Al,Si)N Coatings Deposited by Gas Flow Sputtering with Pulsed DC Supply In: Advanced engineering materials, 24 (4), 2101021, 2021 [DOI: 10.1002/adem.202101021] | Bobzin, Kirsten Kalscheuer, Christian Hassanzadegan Aghdam, Parisa (Corresponding author) |
Durability of nanolayer Ti-Al-O-N hard coatings under simulated polycarbonate melt processing conditions In: Journal of physics / D, 55 (3), 035204, 2021 [DOI: 10.1088/1361-6463/ac2e31] | Brögelmann, Tobias Bobzin, Kirsten Grundmeier, G. de los Arcos, T. Kruppe, Nathan Christopher Schwiderek, S. Carlet, Marco (Corresponding author) |
Crack Resistance of Diamond‐Like Carbon Coatings : Investigations with Nanoindentation In: Vakuum in Forschung und Praxis, 33 (6), 36-42, 2021 [DOI: 10.1002/vipr.202100769] | Bobzin, Kirsten Brögelmann, Tobias Carlet, Marco (Corresponding author) Kruppe, Nathan Christopher Engels, Martin Gottfried Arghavani, Mostafa |
Self-lubricating CrAlVN coatings for turning of Ti6Al4V: oxidation and wear behavior In: Materials science and engineering technology, 52 (12), 1394-1412, 2021 [DOI: 10.1002/mawe.202100042] | Bobzin, Kirsten Brögelmann, Tobias Stachowski, Nina Isabell Inge (Corresponding author) Hintze, W. Möller, C. Ploog, P. |
Tribologischer und korrosiver Einfluss von Grafit in thermisch gespritzten Cr3C2/NiCr-Beschichtungen In: Thermal spray bulletin, 14 (2), 112-119, 2021 | Bobzin, Kirsten Wietheger, Wolfgang Burbaum, Elisa Schulz, Marvin |
Structural analyses of a CrN/AlN nanolaminate hard coating after nanoscratch test In: Thin solid films, 738, 138964, 2021 [DOI: 10.1016/j.tsf.2021.138964] | Bobzin, Kirsten Brögelmann, Tobias Mayer, Joachim Iskandar, Mohamad Riza Kruppe, Nathan Christopher Naderi, Mona (Corresponding author) |
Influence of the Titanium Inoculation on the Melting Behavior and Microstructure of Ni 620/X38CrMoV5-1 Brazing Joints In: Advanced engineering materials, 23 (12), 2100497, 2021 [DOI: 10.1002/adem.202100497] | Bobzin, Kirsten Wietheger, Wolfgang Hebing, Julian (Corresponding author) |
Understanding the Tribological Behavior of Graded (Cr,Al)N + Mo:S in Fluid-Free Friction Regime In: Tribology letters, 69 (4), 162, 2021 [DOI: 10.1007/s11249-021-01536-5] | Bobzin, Kirsten Kalscheuer, Christian Thiex, Matthias (Corresponding author) |
Thermal stability of CrAlN/AlCrN nanolaminate coating deposited by hybrid dcMS/HPPMS after heat treatment with continuous-wave laser In: Applied surface science, 569, 151024, 2021 [DOI: 10.1016/j.apsusc.2021.151024] | Bobzin, Kirsten Brögelmann, Tobias Mayer, Joachim Aretz, Anke Iskandar, Mohamad Riza Kruppe, Nathan Christopher Naderi, Mona (Corresponding author) |
Influence of Aluminum Content on the Impact Fatigue of HPPMS CrAlN Coatings on Tool Steel In: Physical mesomechanics, 24 (5), 625-632, 2021 [DOI: 10.1134/S1029959921050143] | Bobzin, Kirsten Kalscheuer, Christian Carlet, Marco Tayyab, Muhammad (Corresponding author) |
Thermisch gespritzte Beschichtungen für den Armaturenbau In: Materials science and engineering technology, 52 (9), 997-1011, 2021 [DOI: 10.1002/mawe.202100032] | Bobzin, Kirsten Wietheger, Wolfgang Heinemann, Hendrik Schulz, Marvin (Corresponding author) Oechsner, Matthias Engler, T. Scheerer, H. Joung, Y. |
Influence of a short reverse positive HPPMS pulse on the deposition of CrAlN In: Surface and coatings technology, 423, 127625, 2021 [DOI: 10.1016/j.surfcoat.2021.127625] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Eichenhofer, G. Schulze, Christoph Franz Robert (Corresponding author) |
Influence of residual stresses in hard tool coatings on the cutting performance In: Journal of manufacturing processes, 69, 340-350, 2021 [DOI: 10.1016/j.jmapro.2021.08.011] | Bobzin, Kirsten Brögelmann, Tobias Maier, Hans Jürgen Heidenblut, Torsten Kahra, Christoph Carlet, Marco (Corresponding author) |
HPPMS tool coatings: Chip formation and friction In: Vakuum in Forschung und Praxis, 33 (4), 26-33, 2021 [DOI: 10.1002/vipr.202100765] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Carlet, Marco (Corresponding author) Hoffmann, Dennis Christopher Breidenstein, Bernd Krödel-Worbes, Alexander Beblein, Sascha |
Smart PVD hard coatings with temperature sensor function In: Surface and coatings technology, 423, 127631, 2021 [DOI: 10.1016/j.surfcoat.2021.127631] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Janowitz, Julia (Corresponding author) |
Particle tailored effective particle-gas interaction coefficients during plasma spraying In: Thermal spray bulletin, 14 (1), 40-45, 2021 | Bobzin, Kirsten Wietheger, Wolfgang Heinemann, Hendrik Alkhasli, Ilkin |
Prediction of Particle Properties in Plasma Spraying based on Machine Learning In: Journal of thermal spray technology, 30 (7), 1751-1764, 2021 [DOI: 10.1007/s11666-021-01239-2] | Bobzin, Kirsten Wietheger, Wolfgang Heinemann, Hendrik Dokhanchi, Seyed Ruhollah (Corresponding author) Rom, Christian Michael Visconti, Giuseppe |
Pulse synchronized substrate bias for the High Power Pulsed Magnetron Sputtering deposition of CrAlN In: Thin solid films, 732, 138792, 2021 [DOI: 10.1016/j.tsf.2021.138792] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Engels, Martin Gottfried Schulze, Christoph Franz Robert (Corresponding author) |
Design of a TiAlON multilayer coating : Oxidation stability and deformation behavior In: Surface and coatings technology, 421, 127417, 2021 [DOI: 10.1016/j.surfcoat.2021.127417] | Bobzin, Kirsten Kalscheuer, Christian Grundmeier, G. de los Arcos, T. Schwiderek, S. Carlet, Marco (Corresponding author) |
Self-lubricating triboactive (Cr,Al)N+Mo:S coatings for fluid-free applications In: Journal of materials science, 56 (27), 15040-15060, 2021 [DOI: 10.1007/s10853-021-06255-9] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Thiex, Matthias (Corresponding author) |
Use of displacement and force sensors to improve process control during induction brazing of carbide-steel joints In: Welding and cutting, 20 (1), 50-56, 2021 | Bobzin, Kirsten Wietheger, Wolfgang Hebing, Julian |
Investigation on the incorporation of oxygen and thermal stability of HPPMS TiAlCrSiON nanolayer coatings In: Surface and coatings technology, 418, 127231, 2021 [DOI: 10.1016/j.surfcoat.2021.127231] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Carlet, Marco (Corresponding author) |
Development of Thermal Spray Processes for Depositing Coatings on Thermoplastics In: Journal of thermal spray technology : JTST, 30 (1/2), 157-167, 2021 [DOI: 10.1007/s11666-020-01147-x] | Bobzin, Kirsten Wietheger, Wolfgang Knoch, Martin Andreas (Corresponding author) |
DLC coated spur gears : Part II : coating properties and potential for industrial use In: Industrial Lubrication and Tribology, 73 (4), 621-634, 2021 [DOI: 10.1108/ILT-07-2020-0256] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Thiex, Matthias Schwarz, Andreas Ebner, Martin Lohner, Thomas Stahl, Karsten |
STEM investigations of the influence of copper on alumina scale detachment during in-situ wetting experiments of Al-7Si-0.3Mg alloy with 95Sn-5Cu filler metal In: International journal of materials research : IJMR, 112 (5), 415-421, 2021 [DOI: 10.1515/ijmr-2020-8028] | Vayyala, Ashok Aretz, Anke Bobzin, Kirsten Wietheger, Wolfgang Hebing, Julian (Corresponding author) Iskandar, Mohamad Riza Mayer, Joachim Schmidt, Alexander |
High-Speed Video Analysis of the Process Stability in Plasma Spraying In: Journal of thermal spray technology : JTST, 30 (4), 987-1000, 2021 [DOI: 10.1007/s11666-021-01159-1] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Alkhasli, Ilkin Heinemann, Hendrik (Corresponding author) |
DLC-coated spur gears : part I: friction reduction In: Industrial lubrication & tribology, 73 (3), 457-469, 2021 [DOI: 10.1108/ILT-07-2020-0257] | Schwarz, Andreas Ebner, Martin Lohner, Thomas Stahl, Karsten Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Thiex, Matthias |
Thermally sprayed sensor coatings for spatially resolved temperature detection In: Journal of materials processing technology, 291, 117043, 2021 [DOI: 10.1016/j.jmatprotec.2021.117043] | Bobzin, Kirsten Wietheger, Wolfgang Knoch, Martin Andreas Heinemann, Hendrik Schacht, Andreas (Corresponding author) Gillner, Arnold Hummel, Marc Daniel |
Softening Behavior of Cold-Sprayed Aluminum-Based Coatings AA1200 and AA7075 During Annealing In: Journal of thermal spray technology : JTST, 30 (1/2), 358-370, 2020 [DOI: 10.1007/s11666-020-01121-7] | Bobzin, Kirsten Wietheger, Wolfgang Hebing, Julian Gerdt, Leonid (Corresponding author) |
Enhancement of the insulation properties of thermal sprayed ceramic bearing coatings In: Bearing world journal, 5, 35-46, 2020 | Bobzin, Kirsten Wietheger, Wolfgang Knoch, Martin Andreas Burbaum, Elisa Hosenfeldt, Tim Bagcivan, Nazlim Öte, Mehmet Heckl, Astrid Müller, Björn Kunde, Carsten Elsner, Anna-Lena |
HPPMS TiAlCrSiN - Influence of substrate bias and pulse frequency on cutting performance In: Surface and coatings technology, 397, 126056, 2020 [DOI: 10.1016/j.surfcoat.2020.126056] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Carlet, Marco (Corresponding author) |
Steigerung der Leistungsfähigkeit technischer Kunststoffe durch DLC-Beschichtungen In: Tribologie und Schmierungstechnik, 67, 15-24, 2020 [DOI: 10.30419/TuS-2020-0014] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Thiex, Matthias |
PVD Coated Tools and Surface-Structured Workpieces in Dry Cold Forming of Steel In: Defect and diffusion forum, 404, 19-27, 2020 [DOI: 10.4028/www.scientific.net/DDF.404.19] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Bergs, Thomas Mattfeld, Patrick-Marcel Trauth, Daniel Hild, Rafael Hoffmann, Dennis Christopher (Corresponding author) |
Temperature Measurement on Tool Surfaces by Wear Resistant PVD Sensor Coatings In: Defect and diffusion forum, 404, 138-145, 2020 [DOI: 10.4028/www.scientific.net/DDF.404.138] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Janowitz, Julia (Corresponding author) |
Self-Lubricating PVD Hard Coatings Through Tribological Activation In: Defect and diffusion forum, 404, 109-116, 2020 [DOI: 10.4028/www.scientific.net/DDF.404.109] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Stachowski, Nina Isabell Inge (Corresponding author) |
Combination of a laser deposition welded corrosion protection coating and a thermally sprayed wear protection coating In: Thermal spray bulletin, 13 (2), 114-121, 2020 | Bobzin, Kirsten Wietheger, Wolfgang Knoch, Martin Andreas Sommer, Jan Schleifenbaum, Johannes Henrich |
Nutzung von Weg- und Kraftsensoren zur Verbesserung der Prozesskontrolle beim Induktionslöten von Hartmetall-Stahl-Fügeverbunden In: Schweissen und Schneiden, 72 (11), 694-701, 2020 | Bobzin, Kirsten Wietheger, Wolfgang Hebing, Julian |
Effects of (Cr,Al)N and (Cr,Al,Mo)N coatings on friction under minimum quantity lubrication In: Surface and coatings technology, 402, 126154 -, 2020 [DOI: 10.1016/j.surfcoat.2020.126154] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian (Corresponding author) Stahl, K. Lohner, T. Yilmaz, M. |
Brazed coatings for steam turbine blades : impact of the tape architecture and composition on mechanical properties In: International journal of materials research : IJMR, 111 (11), 916-922, 2020 [DOI: 10.3139/146.111956] | Bobzin, Kirsten Wietheger, Wolfgang Hebing, Julian Gerdt, Leonid (Corresponding author) Uddin, M. |
Determination of local deposition efficiency based on in-flight particle diagnostics in plasma spraying In: Surface and coatings technology, 399, 126118, 2020 [DOI: 10.1016/j.surfcoat.2020.126118] | Bobzin, Kirsten Wietheger, Wolfgang Heinemann, Hendrik Dokhanchi, Seyed Ruhollah (Corresponding author) |
Heating behaviour of plasma sprayed TiOx/Cr2O3 coatings for injection moulding In: Surface and coatings technology, 399, 126199, 2020 [DOI: 10.1016/j.surfcoat.2020.126199] | Bobzin, Kirsten Wietheger, Wolfgang Knoch, Martin Andreas Schacht, Andreas (Corresponding author) |
Excellence cluster "Internet of Production" (IoP) of the RWTH Aachen - The digital world and production of the future In: Thermal spray bulletin, 13 (1), 12-14, 2020 | Brockmann, Matthias Wassong, Anja Bobzin, Kirsten Wietheger, Wolfgang Heinemann, Hendrik |
Thermally sprayed coatings for highly stressed sliding bearings In: Wear : an international journal on the science and technology of friction, lubrication and wear, 458/459, 203415, 2020 [DOI: 10.1016/j.wear.2020.203415] | Bobzin, Kirsten Wietheger, Wolfgang (Corresponding author) Jacobs, Georg Bosse, Dennis Schröder, Tim Rolink, Amadeus Franziskus |
Formation mechanisms of zinc, molybdenum, sulfur and phosphorus containing reaction layers on a diamond-like carbon (DLC) coating In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 51 (7), 1009-1030, 2020 [DOI: 10.1002/mawe.201900178] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Thiex, Matthias (Corresponding author) |
Dry forming of low alloy steel materials by full forward impact extrusion with self-lubricating tool coatings and structured workpieces In: Dry metal forming open access journal : DMFOAJ, 6, 69-98, 2020 [DOI: 10.26092/elib/167] | Bobzin, Kirsten Klocke, Fritz Bergs, Thomas Brögelmann, Tobias Feuerhack, Andreas Kruppe, Nathan Christopher Hild, Rafael (Corresponding author) Hoffmann, Dennis Christopher (Corresponding author) |
Further development of iron-based, titanium carbide reinforced thermal spray coatings for wear protection under corrosive loads In: Thermal spray bulletin, 13 (1), 44-51, 2020 | Bobzin, Kirsten Wietheger, Wolfgang Königstein, Tim Denis Stefan Zhao, Lidong malik, katarzyna maria |
Key influencing factors for the thermal shock resistance of La2Zr2O7-based multilayer TBCs In: Surface and coatings technology, 396, 125951, 2020 [DOI: 10.1016/j.surfcoat.2020.125951] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Wietheger, Wolfgang Königstein, Tim Denis Stefan |
A Visit to the Surface Engineering Institte (IOT) of RWTH Aachen University In: Thermal spray bulletin, 43 (1), 22-23, 2020 | Bobzin, Kirsten Wietheger, Wolfgang (Corresponding author) |
Comparison of Residual Stress Measurements Conducted by X-ray Stress Analysis and Incremental Hole Drilling Method In: Journal of thermal spray technology : JTST, 29 (6), 1218-1228, 2020 [DOI: 10.1007/s11666-020-01056-z] | Bobzin, Kirsten Wietheger, Wolfgang Knoch, Martin Andreas Schacht, Andreas (Corresponding author) Reisgen, Uwe Sharma, Rahul Oster, Lukas Emmanuel |
Approaches and possibilities for reducing residual stresses in induction brazed cemented carbide/steel joints In: Welding in the world, 64 (9), 1579-1587, 2020 [DOI: 10.1007/s40194-020-00928-w] | Bobzin, Kirsten Öte, Mehmet Hebing, Julian (Corresponding author) |
Correlation of thermal characteristics and microstructure of multilayer electron beam physical vapor deposition thermal barrier coatings In: Thin solid films, 707, 138081, 2020 [DOI: 10.1016/j.tsf.2020.138081] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Yildirim, Baycan Welters, Martin (Corresponding author) |
Influence of direct electric current on wetting behavior during brazing In: Frontiers of mechanical engineering, 15 (3), 496-503, 2020 [DOI: 10.1007/s11465-019-0582-6] | Bobzin, Kirsten Wietheger, Wolfgang Hebing, Julian Zhao, Lidong Schmidt, Alexander (Corresponding author) Iskandar, Mohamad Riza Mayer, Joachim |
Macroscopic Modeling of an Agglomerated and Sintered Particle in Air Plasma Spraying In: Journal of thermal spray technology, 29, 13-24, 2019 [DOI: 10.1007/s11666-019-00964-z] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Alkhasli, Ilkin (Corresponding author) |
Estimation of Particle Mass Flow Rate in Free Jet Using In-Flight Particle Diagnostics in Plasma Spraying In: Journal of thermal spray technology : JTST, 29 (5), pages921-931, 2020 [DOI: 10.1007/s11666-020-01027-4] | Bobzin, Kirsten Wietheger, Wolfgang Knoch, Martin Andreas Dokhanchi, Seyed Ruhollah (Corresponding author) |
ITSC 2020: Amazing Opportunities Await In: Advanced materials & processes : AM&P, 178 (3), 36-36, 2020 | Bobzin, Kirsten |
Deposition of a nanocomposite (Ti, Al, Si)N coating with high thickness by high-speed physical vapor deposition In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 51 (3), 297-312, 2020 [DOI: 10.1002/mawe.201900103] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Yildirim, Baycan Liang, Tiancheng (Corresponding author) |
Influence of the Injector Head Geometry on the Particle Injection in Plasma Spraying In: Journal of thermal spray technology : JTST, 29 (4), 534-545, 2020 [DOI: 10.1007/s11666-020-01009-6] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Heinemann, Hendrik (Corresponding author) |
Fatigue of brazed joints made of X5CrNi18-10 and Cu110 and derivation of reliable assessment approaches In: Welding in the world, 64 (4), 707-719, 2020 [DOI: 10.1007/s40194-020-00850-1] | Baumgartner, J. (Corresponding author) Tillmann, W. Bobzin, Kirsten Öte, Mehmet Wiesner, Stefanie Sievers, N. |
Arc PVD (Cr,Al,Mo)N and (Cr,Al,Cu)N coatings for mobility applications In: Surface and coatings technology, 384, 125046, 2019 [DOI: 10.1016/j.surfcoat.2019.125046] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian (Corresponding author) |
Self‐Lubricating Physical Vapor Deposition Coatings for Dry Cold Massive Forming In: Steel research international, 91 (5), 1900475, 2019 [DOI: 10.1002/srin.201900475] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Bergs, Thomas Trauth, Daniel Hild, Rafael Mannens, Robby Norbert Hoffmann, Dennis Christopher (Corresponding author) |
Evalution of Two Repair Methods for Duplex-Coatings In: Thermal spray bulletin, 12 (2), 98-104, 2019 | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Prenger, Frank Jantze, Raphael Krömmer, Werner |
Hochleistungsplasmen zur Entwicklung dünner Hartstoffschichten für Werkzeuge In: Werkstoffe in der Fertigung (2), 18-19, 2019 | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Carlet, Marco (Corresponding author) |
Self-lubricating PVD Coatings in Interaction with Textured Workpiece Surfaces for Bulk Metal Forming In: Dry metal forming open access journal, 5, 39-45, 2019 | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Bergs, Thomas Hild, Rafael Feuerhack, Andreas Hoffmann, Dennis Christopher (Corresponding author) |
Structure, mechanical characteristics and thermal stability of high speed physical vapor deposition (Al,Cr)2O3 coatings In: Thin solid films, 690, 137529, 2019 [DOI: 10.1016/j.tsf.2019.137529] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Welters, Martin (Corresponding author) |
Wear behavior and thermal stability of HPPMS (Al,Ti,Cr,Si)ON, (Al,Ti,Cr,Si)N and (Ti,Al,Cr,Si)N coatings for cutting tools In: Surface and coatings technology, 385, 125370, 2019 [DOI: 10.1016/j.surfcoat.2020.125370] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Carlet, Marco (Corresponding author) |
Modellierung des Tribosystems beim trockenen Vollvorwärtsfließ-pressen mithilfe eines erweiterten Reibmodells In: Dry metal forming open access journal, 5, 1-8, 2019 | Bergs, Thomas Hild, Rafael (Corresponding author) Feuerhack, Andreas Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Hoffmann, Dennis Christopher |
Effects of the Ion to Growth Flux Ratio on the Constitution and Mechanical Properties of Cr1-x-Alx-N Thin Films In: ACS combinatorial science, 21 (12), 782-793, 2019 [DOI: 10.1021/acscombsci.9b00123] | Banko, Lars Ries, Stefan Grochla, Dario Arghavani, Mostafa Salomon, Steffen Pfetzing-Micklich, Janine Kostka, Aleksander Rogalla, Detlef Schulze, Julian Awakowicz, Peter Ludwig, Alfred (Corresponding author) |
Nanocomposite (Ti,Al,Cr,Si)N HPPMS coatings for high performance cutting tools In: Surface and coatings technology, 378, 124857, 2019 [DOI: 10.1016/j.surfcoat.2019.07.073] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Carlet, Marco (Corresponding author) |
Investigation on the influence of oxygen on the deformation and cracking behavior of (Cr,Al)ON hard coatings using combinatorial static and dynamic loadings In: Journal of vacuum science & technology / A : JVST, 37 (6), 061509, 2019 [DOI: 10.1116/1.5124615] | Brögelmann, Tobias Bobzin, Kirsten Kruppe, Nathan Christopher Arghavani, Mostafa (Corresponding author) |
Charakterisierung und Bewertung von Emissionen beim Thermischen Spritzen unter produktionsrelevanten Bedingungen In: Thermal spray bulletin, 12 (2), 78-87, 2019 | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan Wietheger, Wolfgang (Corresponding author) Kraus, Thomas Möller, Manfred |
(Cr,Al)N and (Cr,Al,Mo)N hard coatings for tribological applications under minimum quantity lubrication In: Tribology international, 140, 105817, 2019 [DOI: 10.1016/j.triboint.2019.06.010] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian (Corresponding author) Stahl, K. Lohner, T. Yilmaz, M. |
Post-annealing of (Ti,Al,Si)N coatings deposited by high speed physical vapor deposition (HS-PVD) In: Surface and coatings technology, 375, 752-762, 2019 [DOI: 10.1016/j.surfcoat.2019.06.100] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Liang, Tiancheng (Corresponding author) |
Understanding the deformation and cracking behavior of Cr-based coatings deposited by hybrid direct current and high power pulse magnetron sputtering : From nitrides to oxynitrides In: Thin solid films, 688, 137354, 2019 [DOI: 10.1016/j.tsf.2019.06.004] | Brögelmann, Tobias Bobzin, Kirsten Kruppe, Nathan Christopher Arghavani, Mostafa (Corresponding author) |
Influence of Microstructures on Thermal Shock and Sintering Behavior of YSZ-Based Thermal Barrier Coatings In: Surface technology, 48 (4), 28-33, 2019 [DOI: 10.16490/j.cnki.issn.1001-3660.2019.04.004] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Öte, Mehmet Königstein, Tim Denis Stefan |
Laserstrukturierte nitridische und oxinitridische Beschichtungen abgeschieden mittels Mittelfrequenz‐Magnetron‐Sputtering In: International journal of material science, 50 (9), 1057-1069, 2019 [DOI: 10.1002/mawe.201800170] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Naderi, Mona (Corresponding author) |
Incorporation of oxygen at column boundaries in (Cr,Al)ON hard coatings In: Thin solid films, 685, 275-281, 2019 [DOI: 10.1016/j.tsf.2019.06.047] | Brögelmann, Tobias Bobzin, Kirsten Kruppe, Nathan Christopher Carlet, Marco |
Thermal Cyclic Oxidation Behavior of y-TiAl with in situ post-annealed Al-Si-Y Coating In: Journal of vacuum science & technology: JVST, 37 (4), 041401, 2019 [DOI: 10.1116/1.5094835] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Liang, Tiancheng (Corresponding author) |
(Cr,Al)ON Deposited by Hybrid dcMS/HPPMS: A study on Incorporation of Oxygen In: Surface and coatings technology, 369, 238-243, 2019 [DOI: 10.1016/j.surfcoat.2019.04.066] | Brögelmann, Tobias Bobzin, Kirsten Kruppe, Nathan Christopher (Corresponding author) Carlet, Marco |
Potenziale thermisch gespritzter Gleitlager für hochbelastete Lagerstellen In: Thermal spray bulletin, 12 (1), 31-37, 2019 | Bobzin, Kirsten Öte, Mehmet (Corresponding author) Königstein, Tim Denis Stefan (Corresponding author) Wietheger, Wolfgang (Corresponding author) |
Bestimmung der Chromspezies beim Thermischen Spritzen In: Thermal spray bulletin, 41 (1), 18-19, 2019 | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan Wietheger, Wolfgang Kraus, Thomas Möller, Manfred |
PVD-Schutzschichten für Werkzeuge des Präzisionsblankpressens In: Vakuum in Forschung und Praxis, 31 (2), 25-31, 2019 [DOI: 10.1002/vipr.201900711] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Stanek, Bonnie Naderi, Mona (Corresponding author) |
Influence of Oxides on the Performance of Cylinder Bore Coatings of Engine Blocks In: Advanced composite materials, 21 (7), 1900006, 2019 [DOI: 10.1002/adem.201900006] | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan (Corresponding author) |
Analysis of wear phenomena during forward extrusion under dry friction conditions In: Wear : an international journal on the science and technology of friction, lubrication and wear, 426/427 (B), 1362-1370, 2019 [DOI: 10.1016/j.wear.2019.01.127] | Hild, Rafael (Corresponding author) Bergs, Thomas Mattfeld, Patrick-Marcel Trauth, Daniel Klocke, Fritz Hoffmann, Dennis Christopher Kruppe, Nathan Christopher Brögelmann, Tobias Bobzin, Kirsten |
Formation of Tribochemical Reaction Layers on a Metal Modified Amorphous Carbon Coating a-C:H:Zr (ZrCg) In: Tribology international, 135, 152-160, 2019 [DOI: 10.1016/j.triboint.2019.02.040] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Thiex, Matthias (Corresponding author) |
A highly porous thermal barrier coating based on Gd2O3-Yb2O3 co-doped YSZ In: Surface and coatings technology, 366, 349-354, 2019 [DOI: 10.1016/j.surfcoat.2019.03.064] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Öte, Mehmet Königstein, Tim Denis Stefan |
Effect of Different Atomization Gases on the Properties of Cylinder Bore Coatings In: Advanced engineering materials, 21 (2), 1800853, 2018 [DOI: 10.1002/adem.201800853] | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan (Corresponding author) |
Development of a FeCrMnBC-based economical wear and corrosion resistant coating In: Surface and coatings technology, 362, 12-20, 2019 [DOI: 10.1016/j.surfcoat.2019.01.074] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Öte, Mehmet Königstein, Tim Denis Stefan |
Wear behavior of HVOF-sprayed Al0.6TiCrFeCoNi high entropy alloy coatings at different temperatures In: Surface and coatings technology, 358, 215-222, 2018 [DOI: 10.1016/j.surfcoat.2018.11.052] | Chen, Lijia Bobzin, Kirsten Zhou, Zheng (Corresponding author) Zhao, Lidong Öte, Mehmet Königstein, Tim Denis Stefan Tan, Zhen He, Dingyong |
Macroscopic particle modeling in air plasma spraying In: Surface and coatings technology, 364, 449-456, 2018 [DOI: 10.1016/j.surfcoat.2018.07.056] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Alkhasli, Ilkin (Corresponding author) |
New Material Concepts for Thermally Sprayed Hydrodynamic Bearings In: Journal of thermal spray technology : JTST, 28 (1/2), 305-313, 2019 [DOI: 10.1007/s11666-018-0822-z] | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan Wietheger, Wolfgang (Corresponding author) Schröder, Tim Jacobs, Georg Bosse, Dennis |
Influence of Powder Size on the Corrosion and Wear Behaviorof HVAF-Sprayed Fe-Based Coatings In: Journal of thermal spray technology : JTST, 28 (1/2), 63-75, 2018 [DOI: 10.1007/s11666-018-0819-7] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Sommer, Jan (Corresponding author) |
Influence of HPPMS on Hybrid dcMS/HPPMS (Cr,Al)N Processes In: Surface and coatings technology, 358, 57-66, 2018 [DOI: 10.1016/j.surfcoat.2018.11.032] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher (Corresponding author) Engels, Martin Gottfried |
Designing the Corrosion Products of ZnAl15: A new Approach to Smart Corrosion Protection Coatings? In: Corrosion science, 155, 217-229, 2017 [DOI: 10.1016/j.corsci.2017.12.015] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas (Corresponding author) |
In situ Analyse beim Löten von Hartmetallen mittels Messungen des elektrischen Widerstandes In: Materials testing, 60 (4), 349-354, 2018 [DOI: 10.3139/120.111165] | Tillmann, Wolfgang Sievers, Norman (Corresponding author) Schmidt, Alexander Timmer, Christian |
Neue Möglichkeiten für Fe-basis Beschichtungen durch HVAF-Spritzen In: 11. Kolloquium Hochgeschwindigkeits-Flammspritzen/HVOF Spraying, 25. und 26. Oktober 2018, Erding : Tagungsunterlagen : conference proceedings / GTS Europe, Linde - The Linde Group, 19-31, 2018 | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan Zhao, Lidong Sommer, Jan Malik, Katarzyna (Corresponding author) |
Dünne PVD-Hartstoffschichten zur Online-Temperaturmessung : Datenerfassung in der Grenzfläche zwischen Werkzeug und Werkstück bzw. Schmelze In: Vakuum in Forschung und Praxis, 30 (6), 28-33, 2018 [DOI: 10.1002/vipr.201800699] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher (Corresponding author) Stalpers, Lore Janowitz, Julia |
Einfluss der Bindereigenschaften und -zersetzung auf die Lötnahtqualität beim großflächigen Fügen mit Lotpasten In: Schweissen und Schneiden, 70 (6), 390-394, 2018 | Bobzin, Kirsten Öte, Mehmet Wiesner, Stefanie Hebing, Julian (Corresponding author) |
Effect of Heat Treatment on the Phase Composition, Microstructure and Mechanical Properties of Al0.6CrFeCoNi and Al0.6CrFeCoNiSi0.3 High-Entropy Alloys In: Metals : open access journal, 8 (11), 974, 2018 [DOI: 10.3390/met8110974] | Chen, Lijia Bobzin, Kirsten Zhou, Zheng (Corresponding author) Zhao, Lidong Öte, Mehmet Königstein, Tim Denis Stefan Tan, Zhen He, Dingyong |
Einfluss verunreinigter Oberflächenzustände auf das Benetzungsverhalten des Lots Ni 620 auf dem Grundwerkstoff 1.4301 In: Schweissen und Schneiden, 70 (8), 566-570, 2018 | Tillmann, Wolfgang (Corresponding author) Eilers, Arne (Corresponding author) Wojarski, Lukas (Corresponding author) Manka, Matthias (Corresponding author) Bobzin, Kirsten (Corresponding author) Öte, Mehmet (Corresponding author) Wiesner, Stefanie (Corresponding author) |
Entwicklung von HPPMS‐Al2O3‐Beschichtungen für die Zerspanung von schwer zerspanbaren Werkstoffen In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 49 (11), 1287-1300, 2018 [DOI: 10.1002/mawe.201800008] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher (Corresponding author) Bastürk, Serhan Klocke, Fritz Gerschwiler, Klaus Kölker, W. Bolz, S. Kohlscheen, J. |
Enhanced PVD process control by online substrate temperature measurement In: Surface and coatings technology, 354, 383-389, 2018 [DOI: 10.1016/j.surfcoat.2018.07.096] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher (Corresponding author) |
Laser-structured high performance PVD coatings In: Surface and coatings technology, 352, 302-312, 2018 [DOI: 10.1016/j.surfcoat.2018.07.094] | Bobzin, Kirsten Brögelmann, Tobias Gillner, Arnold Kruppe, Nathan Christopher He, Chao Naderi, Mona |
A contribution to the thermal effects of DLC coatings on fluid friction in EHL contacts In: Lubrication science, 30 (6), 285-299, 2018 [DOI: 10.1002/ls.1421] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Thiex, Matthias (Corresponding author) Ebner, M. Lohner, T. Stahl, K. |
Thick HS-PVD (Al,Cr)2O3 coatings for challenging cutting and die casting applications In: Thin solid films, 663, 131-142, 2018 [DOI: 10.1016/j.tsf.2018.06.061] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Welters, Martin (Corresponding author) |
Investigations on the substrate bias influence on reactive HPPMS plasmas In: Thin solid films, 663, 62-72, 2018 [DOI: 10.1016/j.tsf.2018.07.048] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Engels, Martin Gottfried (Corresponding author) |
Al-Si and Al-Si-Y coatings deposited by HS-PVD for the oxidation protection of γ-TiAl In: Surface and coatings technology, 350, 587-595, 2018 [DOI: 10.1016/j.surfcoat.2018.06.074] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Liang, Tiancheng (Corresponding author) |
In situ investigation of production processes in a large chamber scanning electron microscope In: Ultramicroscopy, 193, 151-158, 2018 [DOI: 10.1016/j.ultramic.2018.07.002] | Aretz, Anke Ehle, Lisa Christine Häusler, André Bobzin, Kirsten Öte, Mehmet Wiesner, Stefanie Schmidt, Alexander Gillner, Arnold Poprawe, Reinhart Mayer, Joachim (Corresponding author) |
Correlation of HPPMS plasma and coating properties using artificial neural networks In: Surface and coatings technology, 349, 1130-1136, 2018 [DOI: 10.1016/j.surfcoat.2018.06.065] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa Engels, Martin Gottfried (Corresponding author) |
Tribological studies on self-lubricating (Cr,Al)N+Mo:S coatings at elevated temperature In: Surface and coatings technology, 353, 282-291, 2018 [DOI: 10.1016/j.surfcoat.2018.06.067] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Hoffmann, Dennis Christopher (Corresponding author) Klocke, Fritz Mattfeld, Patrick-Marcel Trauth, Daniel Hild, Rafael |
Reibungsreduzierung durch gradierte diamantähnliche Kohlenstoffschichten in EHD-Kontakten des Automobilantriebsstrangs In: Tribologie und Schmierungstechnik, 65 (1), 66-68, 2018 | Brögelmann, Tobias |
12. Aachener Oberflächentechnik Kolloquium : Bericht über die Veranstaltung am 8. Dezember 2017 in Aachen In: Galvanotechnik, 109 (3), 538-539, 2018 | Bobzin, Kirsten |
High temperature oxidation behavior of Al0.6CrFeCoNi and Al0.6CrFeCoNiSi0.3 high entropy alloys In: Journal of alloys and compounds, 764, 845-852, 2018 [DOI: 10.1016/j.jallcom.2018.06.036] | Chen, Lijia Zhou, Zheng (Corresponding author) Tan, Zhen He, Dingyong Bobzin, Kirsten Zhao, Lidong Öte, Mehmet Königstein, Tim Denis Stefan |
Physical Vapour Deposition : Hartstoffbeschichtungen für die Verarbeitung von Polymethylmethacrylat In: Galvanotechnik : Fachzeitschrift für die Praxis der Oberflächenbehandlung: Photovoltaik, Dünnschicht- und Plasmatechnik, Mikrosystemtechnik und Umwelttechnik, 109 (5), 873-884, 2018 | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Naderi, Mona |
Development of HVAF-sprayed novel Fe-based coatings for large area applications In: Thermal spray bulletin, 11 (1), 38-45, 2018 | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Sommer, Jan |
Prozessgrenzen beim Honen thermischer Spritzschichten : Honen korrosionsbeständiger und reibverlustmindernder Eisenbasisschichten für Bohrungsanwendungen In: wt Werkstattstechnik online, 1/2, 63-66, 2018 | Dröder, Klaus Hoffmeister, Hans-Werner Mahlfeld, Georg (Corresponding author) Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan (Corresponding author) Wank, Andreas (Corresponding author) Schläfer, Thomas Wessler, Tobias |
Space-resolved plasma diagnostics in a hybrid (Cr,Al)N process In: Journal of vacuum science & technology / A, 36 (3), 031515, 2018 [DOI: 10.1116/1.5020151] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Engels, Martin Gottfried (Corresponding author) |
Einfluss von Oberflächenstrukturierungen auf die Stempelkraft beim Vollvorwärtsfließpressen von 16MnCr5 In: Dry metal forming open access journal, 4, 25-30, 2017 | Klocke, Fritz Hild, Rafael (Corresponding author) Trauth, Daniel Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Hoffmann, Dennis Christopher |
Developmement of Novel Fe-Based Coating Systems for Internal Combustion Engines In: Journal of thermal spray technology : JTST, 27 (4), 736-745, 2018 [DOI: 10.1007/s11666-018-0705-3] | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan (Corresponding author) Dröder, Klaus Hoffmeister, Hans-Werner Mahlfeld, Georg Schäfer, Thomas |
Effect of Alloying Elements on Growth Behavior of Intermetallic Compounds at the Cold-Sprayed Coating/Steel Interface During Immersion in Aluminum Melt In: International journal of metalcasting : IJMC, 12 (4), 712-721, 2018 [DOI: 10.1007/s40962-017-0205-0] | Bobzin, Kirsten Öte, Mehmet Wiesner, Stefanie Gerdt, Leonid (Corresponding author) Bührig-Polaczek, Andreas Brachmann, Johannes |
A novel approach for the prediction of deformation and fracture in hard coatings : Comparison of numerical modeling and nanoindentation tests In: Mechanics of materials, 117, 192-201, 2017 [DOI: 10.1016/j.mechmat.2017.11.006] | Rezaei, Shahed (Corresponding author) Arghavani, Mostafa Wulfinghoff, Stephan Kruppe, Nathan Christopher Brögelmann, Tobias Reese, Stefanie Bobzin, Kirsten |
Transfer of Wire Arc-Sprayed Metal Coatings onto Plastic Parts In: Journal of thermal spray technology, 27 (1-2), 119-134, 2017 [DOI: 10.1007/s11666-017-0667-x] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Liao, Xifang (Corresponding author) Hopmann, Christian Ochotta, Philipp |
Replication of micro-structured injection molds using physical vapor deposition coating and dynamic laser mold tempering In: Journal of polymer engineering, 38 (3), 315-322, 2017 [DOI: 10.1515/polyeng-2017-0131] | Hopmann, Christian Bobzin, Kirsten Brögelmann, Tobias Orth, Magnus Johannes (Corresponding author) Kruppe, Nathan Christopher Naderi, Mona |
Impact wear of an HVOF-sprayed Cr3C2-NiCr coating In: International journal of refractory metals & hard materials, 70, 191-196, 2017 [DOI: 10.1016/j.ijrmhm.2017.10.011] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Öte, Mehmet Königstein, Tim Denis Stefan Steeger, Martin |
Tribologischer Einsatz eisenbasierter Wärmedämmschichten in Verbrennungsmotoren In: Tribologie und Schmierungstechnik, 64 (3), 5-10, 2017 | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan Yao, Haihau |
Mechanical and tribological characterization of self-lubricating (Cr1-xAlx)N coatings for deposition on complex-shaped forging tools In: Dry metal forming open access journal, 3, 81-89, 2017 | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa Hoffmann, Dennis Christopher Klocke, Fritz Mattfeld, Patrick-Marcel Trauth, Daniel Hild, Rafael (Corresponding author) |
Korrelation der Haftzugfestigkeit thermisch gespritzter Beschichtungen mit der Substrattopografie In: Thermal spray bulletin, 10 (2), 118-125, 2017 | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Sommer, Jan (Corresponding author) |
Beschichtungen für stoff- und formschlüssige Al-Schmelze/Stahlblech-Hybridbauteile In: Jahrbuch Oberflächentechnik, 73, 139-145, 2017 | Bobzin, Kirsten Bührig-Polaczek, Andreas Öte, Mehmet Wiesner, Stefanie Gerdt, Leonid (Corresponding author) Brachmann, Johannes |
Physical Vapour Deposition : Hartstoffbeschichtungen für die Verarbeitung von Polymethylmethacrylat In: Jahrbuch Oberflächentechnik, 73, 116-127, 2017 | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Naderi, Mona |
High temperature oxidation protection of γ-titanium aluminide using (Cr,Al)ON coatings deposited by high-speed physical vapor deposition In: Surface and coatings technology, 332, 2-11, 2017 [DOI: 10.1016/j.surfcoat.2017.09.071] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Liang, Tiancheng (Corresponding author) |
Correlation of the Debye sheath thickness and (Cr,Al)N coating properties for HPPMS, dcMS, CAE and PCAE processes In: Surface and coatings technology, 332, 233-241, 2017 [DOI: 10.1016/j.surfcoat.2017.06.091] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Engels, Marita (Corresponding author) |
Advanced deposition of hard a-C:Me coatings by HPPMS using Ne as process gas In: Surface and coatings technology, 332, 242-252, 2017 [DOI: 10.1016/j.surfcoat.2017.07.089] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Engels, Martin Gottfried (Corresponding author) |
Plastic deformation behavior of nanostructured CrN/AlN multilayer coatings deposited by hybrid dcMS/HPPMS In: Surface and coatings technology, 332, 253-261, 2017 [DOI: 10.1016/j.surfcoat.2017.06.092] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa (Corresponding author) Mayer, Joachim Weirich, Thomas E. |
11. Aachener Oberflächentechnik Kolloquium In: Galvanotechnik, 108, 1224-1225, 2017 | Bobzin, Kirsten |
Triboactive CrAlN+X hybrid dcMS/HPPMS PVD nitride hard coatings for friction and wear reduction on components In: Surface and coatings technology, 332, 452-463, 2017 [DOI: 10.1016/j.surfcoat.2017.06.089] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian (Corresponding author) |
Microstructural analysis of germanium modified tin-copper brazing filler metals for transient liquid phase bonding of aluminium In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 48 (12), 1257-1263, 2017 [DOI: 10.1002/mawe.201700155] | Iskandar, Mohamad Riza (Corresponding author) Schwedt, Alexander Mayer, Joachim Rochala, Patrick Wiesner, Stefanie Öte, Mehmet Bobzin, Kirsten Weirich, Thomas E. |
Formation of the reaction zone between tin-copper brazing fillers and aluminum-silicon-magnesium alloys : Experiments and thermodynamic analysis In: Materials science and engineering technology = Materialwissenschaft und Werkstofftechnik, 48 (12), 1241-1248, 2017 [DOI: 10.1002/mawe.201700152] | Bobzin, Kirsten Öte, Mehmet Wiesner, Stefanie Schmidt, Alexander (Corresponding author) Apel, M. Berger, R. Aretz, Anke Mayer, Joachim |
Residual stress measurement in AlSi alloys In: Materialwissenschaft und Werkstofftechnik = Materialwissenschaft und Werkstofftechnik, 48 (12), 1270-1275, 2017 [DOI: 10.1002/mawe.201700157] | Reisgen, Uwe Sharma, Rahul (Corresponding author) Gach, Stefan Olschok, Simon Francis, J. Bobzin, Kirsten Öte, Mehmet Wiesner, Stefanie Knoch, Martin Andreas Schmidt, Alexander |
Correlative plasma-surface model for metastable Cr-Al-N: Frenkel pair formation and influence of the stress state on the elastic properties In: Journal of applied physics, 121 (21), 215108, 2017 [DOI: 10.1063/1.4985172] | Music, Denis (Corresponding author) Banko, Lars Rueß, Holger Engels, Martin Gottfried Hecimovic, Ante Grochla, Dario Rogalla, Detlef Brögelmann, Tobias Ludwig, Alfred von Keudell, Achim Bobzin, Kirsten Schneider, Jochen M. |
Thermal Conductivity and Wear Behavior of HVOF-Sprayed Fe-Based Amorphous Coatings In: Coatings : open access journal, 7 (10), 173, 2017 [DOI: 10.3390/coatings7100173] | Yao, Haihua Zhou, Zheng (Corresponding author) Wang, Liang Tan, Zhen He, Dingyong Zhao, Lidong |
Enhanced replication ratio of injection molded plastic parts by using an innovative combination of laser-structuring and PVD coating In: Surface and coatings technology, 332, 474-483, 2017 [DOI: 10.1016/j.surfcoat.2017.09.068] | Bobzin, Kirsten Hopmann, Christian Gillner, Arnold Brögelmann, Tobias Kruppe, Nathan Christopher Orth, Magnus Johannes Steger, Michael Naderi, Mona (Corresponding author) |
Entwicklung einer neuartigen wirtschaftlichen, eisenbasierten Beschichtung zur Erhöhung der Lebensdauer von Gussbauteilen unter dem Gesichtspunkt der Korrosionsbeständigkeit In: Materialwissenschaft und Werkstofftechnik, 48 (9), 922-935, 2017 [DOI: 10.1002/mawe.201700165] | Bobzin, Kirsten Zhao, Lidong Öte, Mehmet Königstein, Tim Denis Stefan Oechsner, M. Siebers, M. (Corresponding author) Andersohn, G. Ellermeier, J. |
A Contribution to explain the Mechanisms of Adhesive Wear in Plastics Processing by example of Polycarbonate In: Surface and coatings technology, 332, 464-473, 2017 [DOI: 10.1016/j.surfcoat.2017.07.080] | Bobzin, Kirsten Brögelmann, Tobias Grundmeier, Guido de los Arcos, Teresa Wiesing, M. Kruppe, Nathan Christopher (Corresponding author) |
Simulation of the Particel Melting Degree in air Plasma Spraying In: Journal of physics / Conference Series, 825, 012002, 2017 [DOI: 10.1088/1742-6596/825/1/012002] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Alkhasli, Ilkin (Corresponding author) Reisgen, Uwe Mokrov, Oleg Lisnyi, Oleksii |
Kunststoffe metallisieren In: KunststoffXtra : Fachberichte, Messen, News, 7 (1/2), 11-15, 2017 | Hopmann, Christian Ochotta, Philipp (Corresponding author) Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Liao, Xifang |
Fundamental study of an industrial reactive HPPMS (Cr,Al)N process In: Journal of applied physics, 122 (1), 015302, 2017 [DOI: 10.1063/1.4990997] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Engels, Martin Gottfried (Corresponding author) von Keudell, A. Hecimovic, A. Ludwig, A. Grochla, Dario Banko, Lars |
Mechanical and tribiological characterization of self-lubricating (Cr1-xAlx)N coatings for deposition on complex-shaped forging tools In: Dry metal forming open access journal, 3, 81-89, 2017 [DOI: 10.18154/RWTH-2017-06971] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa (Corresponding author) Hoffmann, Dennis Christopher Klocke, Fritz Mattfeld, Patrick-Marcel Trauth, Daniel Hild, Rafael |
Investigations on Mechanical and Tribological Behavior of dcMS/HPPMS CrN and (Cr,Al)N Hard Coatings Using Nanoscratch Technique In: Advanced engineering materials, 19 (6), 1600632, 2017 [DOI: 10.1002/adem.201600632] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa (Corresponding author) |
Nitridische und oxinitridische HPPMS-Beschichtungen für den Einsatz in der Kunststoffverarbeitung (Teil 2) : Einfluss einer Sauerstoffvariation in (Cr,Al)ON-Beschichtungen auf die chemische Zusammensetzung der nativen Reaktionsschicht, sowie das Benetzungsverhalten gegenüber geschmolzenem und die Haftzugfestigkeit von erstarrtem Polycarbonat In: Vakuum in Forschung und Praxis, 29 (1), 24-28, 2017 [DOI: 10.1002/vipr.201700634] | Bobzin, Kirsten Grundmeier, Guido Brögelmann, Tobias de los Arcos, Teresa Wiesing, Martin Kruppe, Nathan Christopher (Corresponding author) |
High-rate deposition of thick (Cr,Al)ON coatings by high speed physical vapor deposition In: Surface and coatings technology, 322, 152-162, 2017 [DOI: 10.1016/j.surfcoat.2017.05.034] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Liang, Tiancheng (Corresponding author) |
Thermal cycling and isothermal oxidation behavior of quadruple EB-PVD thermal barrier coatings In: Materialwissenschaft und Werkstofftechnik, 48 (6), 502-518, 2017 [DOI: 10.1002/mawe.201600723] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Yildirim, Baycan Welters, Martin (Corresponding author) |
How dry is dry? A critical analysis of surface conditions used in dry metal forming In: Dry metal forming open access journal, 3, 90-94, 2017 | Almohallami, Amer Arghavani, Mostafa Böhmermann, F. Freiße, H. Herrmann, M. Mousavi, S. A. Schöler, S. Scholz, P. Tenner, J. Umlauf, Georg Teller, Marco Wulff, D. Yilkiran, D. Maier, Hans Jürgen (Corresponding author) |
Untersuchung der Einflussfaktoren auf die Übertragung von lichtbogendrahtgespritzten Zn-Beschichtungen für die Metallisierung von Kunststoffbauteilen In: Thermal spray bulletin, 10 (1), 43-49, 2017 | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas Liao, Xifang Hopmann, Christian Ochotta, Philipp |
Trockenumformung von 42CrS4 mittels Vollvorwärtsfließpressen durch strukturierte Halbzeugoberflächen und selbstschmierende Werkzeugbeschichtungen In: Dry metal forming open access journal, 4, 7-12, 2017 [DOI: 10.18154/RWTH-2017-04884] | Klocke, Fritz Hild, Rafael (Corresponding author) Trauth, Daniel Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa |
Numerical Study on Plasma Jet and Particle Behavior in Multi-arc Plasma Spraying In: Journal of thermal spray technology : JTST, 26 (5), 811-830, 2017 [DOI: 10.1007/s11666-017-0564-3] | Bobzin, Kirsten Öte, Mehmet (Corresponding author) Schein, J. Zimmermann, S. |
Numerical Coupling of the Particulate Phase to the Plasma Phase in Modeling of Multi-Arc Plasma Spraying In: Journal of physics / Conference Series, 825, 012003, 2017 [DOI: 10.1088/1742-6596/825/1/012003] | Bobzin, Kirsten Öte, Mehmet (Corresponding author) |
High-performance coatings for cutting tools In: CIRP journal of manufacturing science and technology : CIRP-JMST, 18, 1-9, 2016 [DOI: 10.1016/j.cirpj.2016.11.004] | Bobzin, Kirsten (Corresponding author) |
Investigation of Amorphous/Nanocrystalline Iron-Based Thermal Barrier Coatings In: Journal of thermal spray technology : JTST, 26 (3), 388-397, 2017 [DOI: 10.1007/s11666-016-0520-7] | Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan (Corresponding author) |
Influence of Feedstock Materials and Spray Parameters on Thermal Conductivity of Wire-Arc-Sprayed Coatings In: Journal of materials engineering and performance, 26 (3), 1108-1113, 2017 [DOI: 10.1007/s11665-017-2567-0] | Yao, H. H. Zhou, Zhe (Corresponding author) Wang, G. H. He, D. Y. Bobzin, Kirsten Zhao, Lidong Öte, Mehmet Königstein, Tim Denis Stefan |
Microstructure and Properties of FeCrB Alloy Coatings Prepared by Wire-Arc Spraying In: Journal of thermal spray technology : JTST, 26 (3), 483-491, 2017 [DOI: 10.1007/s11666-016-0510-9] | Yao, H. H. Zhou, Zhe (Corresponding author) Wang, Yu-Ming He, D. Y. Bobzin, Kirsten Zhao, Lidong Öte, Mehmet Königstein, Tim Denis Stefan |
Surface Pre-treatment for Thermally Sprayed ZnAl15 Coatings In: Journal of thermal spray technology : JTST, 26 (3), 464-472, 2017 [DOI: 10.1007/s11666-016-0507-4] | Bobzin, Kirsten Öte, Mehmet Knoch, Martin Andreas (Corresponding author) |
Modeling Plasma-Particle Interaction in Multi-Arc Plasma Spraying In: Journal of thermal spray technology : JTST, 26 (3), 279-291, 2017 [DOI: 10.1007/s11666-016-0514-5] | Bobzin, Kirsten Öte, Mehmet (Corresponding author) |
Characterization of DC magnetron plasma in Ar/Kr/N 2 mixture during deposition of (Cr,Al)N coating In: Journal of physics / D, Applied physics, 50 (7), 075203, 2017 [DOI: 10.1088/1361-6463/aa4ea2] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, S. Brugnara, Ricardo H. Bibinov, N. (Corresponding author) Awakowicz, P. |
Influence of long time post annealing on thermal stability and thermophysical properties of plasma sprayed La2Zr2O7 coatings In: Journal of alloys and compounds : JAL, 695, 2549-2555, 2016 [DOI: 10.1016/j.jallcom.2016.10.328] | Erdogan, Garip (Corresponding author) Ustel, Fatih Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Zhao, Lidong |
Evaluation of the shear stresses on surface structured workpieces in dry forming using a novel pin-on-cylinder tribometer with axial feed In: International journal of material forming, 10 (4), 557-565, 2016 [DOI: 10.1007/s12289-016-1301-z] | Trauth, Daniel (Corresponding author) Bastürk, Serhan Hild, Rafael Mattfeld, Patrick-Marcel Brögelmann, Tobias Bobzin, Kirsten Klocke, Fritz |
Novel Fe-based wear and corrosion resistant coatings by three-cathode plasma technology In: Surface and coatings technology, 318, 288-292, 2016 [DOI: 10.1016/j.surfcoat.2016.08.041] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Öte, Mehmet Königstein, Tim Denis Stefan |
Nitridische und oxinitridische HPPMS-Beschichtungen für den Einsatz in der Kunststoffverarbeitung (Teil 1) : Einfluss einer Sauerstoffvariation auf Schichteigenschaften von (Cr,Al)ON und Verbundeigenschaften zwischen Beschichtung und Kunststoffformenstahl In: Vakuum in Forschung und Praxis, 28 (6), 28-33, 2016 [DOI: 10.1002/vipr.201600632] | Bobzin, Kirsten Grundmeier, Guido Brögelmann, Tobias de los Arcos, Teresa Wiesing, Martin Kruppe, Nathan Christopher (Corresponding author) |
Reactive Air Brazing In: Info-Service (34), 2-6, 2016 | Kopp, Nils Bobzin, Kirsten Wiesner, Stefanie |
TiC-verstärkte, stahlbasierte Werkstoffverbunde und innovative Implementierung im thermischen Spritzen In: Dialog, 5, 92-102, 2016 | Bobzin, Kirsten Zhao, Lidong Öte, Mehmet Link, Thomas |
On the plastic deformation of chromium-based nitride hard coatings deposited by hybrid dcMS/HPPMS: A fundamental study using nanoscratch test In: Surface and coatings technology, 308, 298-306, 2016 [DOI: 10.1016/j.surfcoat.2016.05.093] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa (Corresponding author) Mayer, Joachim Weirich, Thomas E. |
Synthesis of a-C coatings by HPPMS using Ar, Ne and He as process gases In: Surface and coatings technology, 308, 80-89, 2016 [DOI: 10.1016/j.surfcoat.2016.07.099] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian Engels, Marita (Corresponding author) |
Influence of dcMS and HPPMS in a dcMS/HPPMS hybrid process on plasma and coating properties In: Thin solid films, 620, 188-196, 2016 [DOI: 10.1016/j.tsf.2016.07.079] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Engels, Martin Gottfried (Corresponding author) |
Thermisch gespritzte Gleitlagerwerkstoffe für die Rotorlagerung von Windenergieanlagen In: Ingenieur-Spiegel : Fachmagazin für Ingenieure / Hellblaue Ausgabe, 2016 (4), 28-29, 2016 | Schröder, Tim (Corresponding author) Jacobs, Georg Bosse, Dennis Bobzin, Kirsten Öte, Mehmet Königstein, Tim Denis Stefan Wietheger, Wolfgang |
Hybrid dcMS/HPPMS PVD nitride and oxynitride hard coatings for adhesion and abrasion reduction in plastics processing In: Surface and coatings technology, 308, 349-359, 2016 [DOI: 10.1016/j.surfcoat.2016.07.103] | Bobzin, Kirsten Brögelmann, Tobias Kalscheuer, Christian (Corresponding author) Naderi, Mona |
Efficiency improvement in automobile bucket tappet/camshaft contacts by DLC coatings : Influence of engine oil, temperature and camshaft speed In: Surface and coatings technology, 308, 360-373, 2016 [DOI: 10.1016/j.surfcoat.2016.09.041] | Dobrenizki, L. Tremmel, S. Wartzack, Sandro Hoffmann, Dennis Christopher Brögelmann, Tobias (Corresponding author) Bobzin, Kirsten Bagcivan, Nazlim Musayev, Y. Hosenfeldt, T. |
Analysis of CrN/AlN/Al2O3 and two industrially used coatings deposited on die casting cores after application in an aluminum die casting machine In: Surface and coatings technology, 308, 374-382, 2016 [DOI: 10.1016/j.surfcoat.2016.09.040] | Bobzin, Kirsten Brögelmann, Tobias Hartmann, U. Kruppe, Nathan Christopher (Corresponding author) |
(Cr,Al)N/(Cr,Al)ON Oxy-nitride Coatings deposited by Hybrid dcMS/HPPMS for Plastics Processing Applications In: Surface and coatings technology, 308, 394-403, 2016 [DOI: 10.1016/j.surfcoat.2016.07.093] | Bobzin, Kirsten Brögelmann, Tobias Grundmeier, G. de los Arcos, Teresa Wiesing, M. Kruppe, Nathan Christopher (Corresponding author) |
Synthesis, characterization, and tribological evaluation of HPPMS (Cr1 − xAlx)N + MoSy coatings In: Surface and coatings technology, 308, 383-393, 2016 [DOI: 10.1016/j.surfcoat.2016.07.089] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Bastürk, Serhan Klocke, Fritz Mattfeld, Patrick-Marcel Trauth, Daniel Hild, Rafael (Corresponding author) |
Influence of Boron Content on Microstructure and Properties of Wire-arc Sprayed Fe-based Coatings In: Thermal spray bulletin, 9 (1), 60-68, 2016 | Yao, Haihua Zhou, Zheng Wang, Yiming He, Ding-Young Bobzin, Kirsten Zhao, Lidong Öte, Mehmet Linke, Thomas Frederik Königstein, Tim Denis Stefan |
Thermisch gespritzte Korrosionsschutzschichten, eine Ergänzung zur Feuerverzinkung! In: WOMag : Kompetenz in Werkstoff und funktioneller Oberfläche, 5 (6), 41, 2016 [DOI: 10.7395/2016/Knoch01] | Bobzin, Kirsten Öte, Mehmet Schulz, Christiane Knoch, Martin Andreas |
Tribologisches Verhalten von eisenbasierten Titankarbid verstärkten thermisch gespritzten Schichten In: Tribologie und Schmierungstechnik, 5, 19-24, 2016 | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Malik, Katarzyna Königstein, Tim Denis Stefan |
Process Development for Innovative Iron Alloy Metallic Glass Coatings In: Advanced engineering materials, 18 (10), 1833-1840, 2016 [DOI: 10.1002/adem.201600177] | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Königstein, Tim Denis Stefan (Corresponding author) |
Effect of long-term heat-treatment at 1150°C on the microstructure and properties of thermal barrier coatings based on ZrO2-4mol.% Y2O3-1mol.% Gd2O3-1mol.% Yb2O3 In: Surface and coatings technology, 318, 142-146, 2016 [DOI: 10.1016/j.surfcoat.2016.06.055] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Öte, Mehmet Königstein, Tim Denis Stefan |
Investigation of Reactive HPPMS Process and Influence of Bias Voltage during Deposition of Alumina Coatings In: Advanced engineering materials, 18 (4), 665-670, 2016 [DOI: 10.1002/adem.201500417] | Bobzin, Kirsten Brögelmann, Tobias Brugnara, Ricardo H. Bastürk, Serhan (Corresponding author) Bagcivan, Nazlim |
Influence of HPPMS pulse parameters on the reactive gas N2 and on the properties of (Cr, Al)N coatings In: Surface and coatings technology, 293, 28-34, 2015 [DOI: 10.1016/j.surfcoat.2015.12.072] | Bobzin, Kirsten Brögelmann, Tobias Brugnara, Ricardo H. Kruppe, Nathan Christopher (Corresponding author) Chromy, Stephan |
Modelling the Plasma Jet in Multi-Arc Plasma Spraying In: Journal of thermal spray technology : JTST, 25 (6), 1111-1126, 2016 [DOI: 10.1007/s11666-016-0438-0] | Bobzin, Kirsten Öte, Mehmet (Corresponding author) Schein, J. Zimmermann, Stephan Möhwald, K. Lummer, C. |
Drei Mikrometer Hightech - Einsatz von PVD-Beschichtungen zur Verbesserung des Extrusionsprozesses In: Kunststoffe, 106 (7), 62-65, 2016 | Hopmann, Christian Höfs, Christopher Frederic (Corresponding author) Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Naderi, Mona |
Minimizing Frictional Losses in Crankshaft Bearings of Automobile Powertrain by Diamond-like Carbon Coatings under Elasto-hydrodynamic Lubrication In: Surface and coatings technology, 290, 100-109, 2016 [DOI: 10.1016/j.surfcoat.2015.08.064] | Bobzin, Kirsten Brögelmann, Tobias (Corresponding author) |
Verformungsverhalten nanostrukturierter HPPMS-Hartstoffschichten In: Vakuum in Forschung und Praxis, 28 (3), 18-25, 2016 [DOI: 10.1002/vipr.201600604] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa (Corresponding author) |
Thermische Auslagerung eines mehrlagigen Oxidationsschutz-Beschichtungssystems für γ-Titaniumaluminide In: Thermal spray bulletin, 9 (1), 34-40, 2016 | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik |
HPPMS (Cr1-xAlx)N+WSy Coatings for the Application in Dry Cold Forging of Steel: Synthesis and Raman Characterization In: Dry metal forming open access journal, 2, 72-77, 2016 [DOI: 10.18154/RWTH-2016-04878] | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Arghavani, Mostafa Bastürk, Serhan (Corresponding author) Klocke, Fritz Mattfeld, Patrick-Marcel Trauth, Daniel Hild, Rafael |
Recommendations for Dry Forming of 16MnCr5 and 42CrMo4 in Cold Forging In: Dry metal forming open access journal, 2, 44-49, 2016 [DOI: 10.18154/RWTH-2016-04874] | Klocke, Fritz Hild, Rafael (Corresponding author) Trauth, Daniel Mattfeld, Patrick-Marcel Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher |
Influence of the Composition on the Properties of (Cr 1-x Al x )N/Mo y S z PVD Coatings In: Advanced engineering materials, 18 (6), 1036-1043, 2016 [DOI: 10.1002/adem.201500499] | Bobzin, Kirsten Brögelmann, Tobias Bastürk, Serhan (Corresponding author) Klocke, Fritz Mattfeld, Patrick-Marcel Trauth, Daniel Polcik, Peter Kolozsvári, Szilárd |
In-Mould-Metal-Spraying - Surface and partial metallisation of plastic parts In: European tool & mould making : ETMM, 18 (5), 38-39, 2016 | Hopmann, Christian Bobzin, Kirsten Ochotta, Philipp (Corresponding author) Öte, Mehmet Knoch, Martin Andreas Liao, Xifang |
Modeling Multi-arc Spraying Systems In: Journal of thermal spray technology, 25 (5), 920-932, 2016 [DOI: 10.1007/s11666-016-0407-7] | Bobzin, Kirsten Öte, Mehmet (Corresponding author) |
Improved molding of micro structures using PVD-coated mold inserts In: Journal of Polymer Engineering, 36 (6), 575-582, 2015 [DOI: 10.1515/polyeng-2015-0270] | Hopmann, Christian Bobzin, Kirsten Brögelmann, Tobias Schäfer, Christian Schöngart, Maximilian Röbig, Malte (Corresponding author) Naderi, Mona |
Wear and Corrosion Resistance of Fe-Based Coatings Reinforced by TiC Particles for Application in Hydraulic Systems In: Journal of thermal spray technology, 25 (1), 365-374, 2015 [DOI: 10.1007/s11666-015-0316-1] | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik (Corresponding author) Malik, Katarzyna |
Influence of Process Parameter on Grit Blasting as a Pretreatment Process for Thermal Spraying In: Journal of thermal spray technology, 25 (1), 3-11, 2015 [DOI: 10.1007/s11666-015-0297-0] | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Sommer, Jan Liao, Xifang (Corresponding author) |
IMKS and IMMS : two methods for the production of plastic parts featuring metallic areas In: Journal of polymer engineering, 36 (6), 549-556, 2015 [DOI: 10.1515/polyeng-2014-0281] | Hopmann, Christian Bobzin, Kirsten Schoeldgen, Roman Öte, Mehmet Wunderle, Johannes Linke, Thomas F. Ochotta, Philipp (Corresponding author) |
In-Mould-Metal-Spraying - Neuer Verfahrensansatz zur Metallisierung von Kunststoffbauteilen In: Werkstoffe in der Fertigung, 52 (2), 16-17, 2015 | Hopmann, Christian Bobzin, Kirsten Ochotta, Philipp Öte, Mehmet Linke, Thomas Frederik Liao, Xifang |
Aluminum-rich HPPMS (Cr1−xAlx)N coatings deposited with different target compositions and at various pulse lengths In: Vacuum : surface engineering, surface instrumentation & vacuum technology, 122 (Part A), 201-207, 2015 [DOI: 10.1016/j.vacuum.2015.09.028] | Bobzin, Kirsten Brögelmann, Tobias Brugnara, R. H. (Corresponding author) |
CrN/AlN and CrN/AlN/Al2O3 coatings deposited by pulsed cathodic arc for aluminum die casting applications In: Surface and coatings technology, 284, 222-229, 2015 [DOI: 10.1016/j.surfcoat.2015.07.074] | Bobzin, Kirsten Brögelmann, Tobias Brugnara, R. H. Kruppe, Nathan Christopher (Corresponding author) |
Analysis of ion energy distribution at the substrate during a HPPMS (Cr,Al)N process using retarding field energy analyzer and energy resolved mass spectrometer In: Thin solid films, 596, 140-146, 2015 [DOI: 10.1016/j.tsf.2015.08.059] | Bobzin, Kirsten Brögelmann, Tobias Brugnara, Ricardo H. Chromy, S. (Corresponding author) |
Investigation on Plastic Behavior of HPPMS CrN, AIN and CrN/AIN-Multilayer Coatings using Finite Element Simulation and Nanoindentation In: Surface and coatings technology, 284, 310-317, 2015 [DOI: 10.1016/j.surfcoat.2015.07.081] | Bobzin, Kirsten Brögelmann, Tobias Brugnara, Ricardo H. Arghavani, Mostafa (Corresponding author) Yang, T.-S. Chang, Y.-Y. Chang, S.-Y. |
Metallisierung von Kunststoffoberflächen - ein neues Verfahren: "In-Mould Metal Spraying (IMMS)" In: Jahrbuch Oberflächentechnik, 71, 68-73, 2015 | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Liao, Xifang Hopmann, Christian Ochotta, Philipp (Corresponding author) |
Influence of wetting and thermophysical properties of diamond-like carbon coatings on the frictional behavior in automobile gearboxes under elasto-hydrodynamic lubrication In: Surface and coatings technology, 248, 290-301, 2015 [DOI: 10.1016/j.surfcoat.2015.06.087] | Bobzin, Kirsten Brögelmann, Tobias (Corresponding author) Stahl, Karsten Stemplinger, Johann-Paul Mayer, Josef Hinterstoißer, M. |
Application of thermal spraying for the manufacture of metal/plastic components In: Thermal Spray Bulletin, 8 (1), 2-5, 2015 | Bobzin, Kirsten Liao, Xifang Linke, Thomas Frederik Öte, Mehmet Hopmann, Christian Ochotta, Philipp |
Numerical Analysis of the Tribological Mode of Action in Cold Forming of Sinus Waved Surface Structures In: Dry metal forming open access journal, 1, 137-142, 2015 | Klocke, Fritz Trauth, Daniel Hild, Rafael (Corresponding author) Mattfeld, Patrick-Marcel Bobzin, Kirsten Brögelmann, Tobias Bastürk, Serhan |
Tribological Behavior of (Cr1-xAlc)N/WSy PVD Tool Coatings for the Application in Dry Cold Forging of Steel In: Dry metal forming open access journal, 1, 152-158, 2015 | Bobzin, Kirsten Brögelmann, Tobias Kruppe, Nathan Christopher Bastürk, Serhan (Corresponding author) Klocke, Fritz Mattfeld, Patrick-Marcel Trauth, Daniel |
Metallisierung von Kunststoffoberflächen - ein neues Verfahren: "In-Mould Metal Spraying (IMMS)" In: Jahrbuch Oberflächentechnik, 71, 67-73, 2015 | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Liao, Xifang Hopmann, Christian Ochotta, P. |
Iron-based, titanium-carbide-reinforced thermally sprayed coatings for hydraulic systems In: Thermal spray bulletin, 8 (2), 148-155, 2015 | Bobzin, Kirsten (Corresponding author) Öte, Mehmet (Corresponding author) Linke, Frederik (Corresponding author) Malik, Katarzyna |
A Numerical Investigation : Air Plasma Spraying by Means of a Three-Cathode Spraying Torch In: Thermal spray bulletin, 8 (2), 118-125, 2015 | Bobzin, Kirsten Öte, Mehmet |
Hochleistungsplasmen zur Synthese diamantähnlicher Kohlenstoffschichten : Einfluss verschiedener Prozessgase und HPPMS-Pulsparameter auf die Plasmaeigenschaften In: Vakuum in Forschung und Praxis, 27 (5), 22-28, 2015 [DOI: 10.1002/vipr.201500591] | Bobzin, Kirsten Brögelmann, Tobias Bastürk, Serhan Engels, Martin Gottfried (Corresponding author) |
Impulse geben : Kooperation für innovative Entwicklungen ; IOT und CemeCon In: Facts / Deutsche Ausgabe, 41 (Juli), 9-10, 2015 | Bobzin, Kirsten Brögelmann, Tobias Bastürk, Serhan |
Laserunterstütztes Drehen von thermisch gespritzten WC-10Co-4Cr-Verschleißschutzschichten In: Thermal spray bulletin, 8 (1), 43-49, 2015 | Bobzin, Kirsten (Corresponding author) Zhao, Lidong (Corresponding author) Öte, Mehmet (Corresponding author) Linke, Thomas Frederik (Corresponding author) Klocke, Fritz Gräfe, Stefan (Corresponding author) Arntz, Kristian (Corresponding author) Brummer, Christoph |
Influence of surface treatment on the bond strength of plastics/metal hybrids In: Zeitschrift Kunststofftechnik, 7, 228-255, 2015 | Hopmann, Christian Wunderle, Johannes Neuß, Andreas Ochotta, Philipp Bobzin, Kirsten Schulz, Christiane Liao, Xifang |
Wear behaviour of hydrogenated DLC in a pin-on-disc model test under lubrication with different diesel fuel types In: Tribology international, 92, 12-20, 2015 [DOI: 10.1016/j.triboint.2015.05.020] | Djoufack, Martin H. (Corresponding author) May, U. Repphun, G. Brögelmann, Tobias Bobzin, Kirsten |
Anwendungen des Thermischen Spritzens für die Herstellung von Metall-Kunststoff-Bauteilen In: Thermal spray bulletin, 8, 28-31, 2015 | Bobzin, Kirsten (Corresponding author) Öte, Mehmet Linke, Thomas Frederik Liao, Xifang Hopmann, Christian Ochotta, Philipp |
Multiscale FE-Studies of Contact Stresses of Dry and Lubricated Shot Peened Workpiece Surfaces In: Dry metal forming open access journal, 1, 11-16, 2015 | Klocke, Fritz Trauth, Daniel (Corresponding author) Mattfeld, Patrick-Marcel Shirobokov, Anton Bobzin, Kirsten Brögelmann, Tobias Bastürk, Serhan |
Development of an in situ Plasma Treatment of X155CrMoV12 for a (Cr,Al)N PVD Tool Coating for Dry Metal Forming in Cold Forging In: Dry metal forming open access journal, 1, 57-62, 2015 | Bobzin, Kirsten Brögelmann, Tobias Bastürk, Serhan (Corresponding author) Klocke, Fritz Mattfeld, Patrick-Marcel Trauth, Daniel |
Friction reduction of highly-loaded rolling-sliding contacts by surface modifications under elasto-hydrodynamic lubrication In: Wear, 328/329, 217-228, 2015 [DOI: 10.1016/j.wear.2015.02.033] | Bobzin, Kirsten Brögelmann, Tobias (Corresponding author) Stahl, K. Michaelis, K. Mayer, J. Hinterstoißer, M. |
Deposition and characterization of thermal barrier coatings of ZrO2-4 mol.% Y2O3-1 mol.% Gd2O3-1 mol.% Yb2O3 In: Surface and coatings technology, 268, 205-208, 2014 [DOI: 10.1016/j.surfcoat.2014.05.051] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Öte, Mehmet Linke, Thomas Frederik |
Preparation of spherical calcium phosphate granulates suitable for the biofunctionalization of active brazed titanium alloy coatings In: Biomedizinische Technik = Biomedical engineering, 60 (2), 105-114, 2014 [DOI: 10.1515/bmt-2014-0017] | Schickle, Karolina Gerardo-Nava, Jose L. (Corresponding author) Puidokas, Sabrina Michelle Samadian Anavar, Sharareh Bergmann, Christian Gingter, Philipp Schickle, Benjamin Bobzin, Kirsten Fischer, Horst |
Corrosion of Wire Arc Sprayed ZnMgAl In: Materials and corrosion = Werkstoffe und Korrosion, 66 (6), 520-526, 2015 [DOI: 10.1002/maco.201407601] | Bobzin, Kirsten Öte, Mehmet Linke, T. F. Schulz, Christiane (Corresponding author) |
Experimental and simulative strain field investigation of nano- and microscratches on nanolaminated (Cr, Al)N coating In: Thin solid films, 573, 33-40, 2014 [DOI: 10.1016/j.tsf.2014.10.095] | Perne, Jan (Corresponding author) |
Strukturen im Mikro-Format : Oberflächenstrukturen an PVD-Beschichteten Werkzeugeinsätze In: Form + Werkzeug, Juni 2014, 65-65, 2014 | Hopmann, Christian (Corresponding author) Bobzin, Kirsten Bagcivan, Nazlim Brögelmann, Tobias Schäfer, Christian Schöngart, Maximilian |
Development of (Cr,Al)ON coatings using middle frequency magnetron sputtering and investigations on tribological behavior against polymers In: Surface and coatings technology, 260, 347-361, 2014 [DOI: 10.1016/j.surfcoat.2014.09.016] | Bagcivan, Nazlim Bobzin, Kirsten Brögelmann, Tobias (Corresponding author) Kalscheuer, Christian |
CrN/AlN nanolaminate coatings deposited via high power pulsed and middle frequency pulsed magnetron sputtering In: Thin solid films, 572, 153-160, 2014 [DOI: 10.1016/j.tsf.2014.06.058] | Bagcivan, N. Bobzin, Kirsten Ludwig, A. Grochla, D. Brugnara, R. H. (Corresponding author) |
Characterization of Reactive Air Brazed Ceramic/Metal Joints with Unadapted Thermal Expansion Behavior In: Advanced engineering materials, 16 (12), 1490-1497, 2014 [DOI: 10.1002/adem.201400311] | Bobzin, Kirsten Öte, Mehmet Wiesner, Stefanie (Corresponding author) Kaletsch, Anke Broeckmann, Christoph |
Influence of Filler and Base Material on the Pore Development during Reactive Air Brazing In: Advanced engineering materials, 16 (12), 1456-1461, 2014 [DOI: 10.1002/adem.201400177] | Bobzin, Kirsten Kopp, Nils Wiesner, Stefanie (Corresponding author) |
Tribological Evaluation of Hydrogenated DLC in Diesel Lubricated Diesel Model Test In: Surface & coatings technology, 258, 381-391, 2014 [DOI: 10.1016/j.surfcoat.2014.08.065] | Djoufack, Martin (Corresponding author) May, Ulrich Bagcivan, Nazlim Brögelmann, Tobias Bobzin, Kirsten |
Comparison of (Ti,Al)N and (Ti,Al)N/gamma-Al2O3 coatings regarding tribological behavior and machining performance In: Surface & coatings technology, 257, 58-62, 2014 [DOI: 10.1016/j.surfcoat.2014.08.070] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, M. Brugnara, R. H. Bastürk, Serhan (Corresponding author) |
High temperature corrosion behaviour of wire arc sprayed Fe based coatings In: Surface engineering, 30 (8), 573-578, 2014 [DOI: 10.1179/1743294414Y.0000000287] | Li, R. (Corresponding author) He, D. Y. Zhou, Z. Zhao, Lidong Song, X. Y. |
Microstructure behaviour and influence on thermally grown oxide formation of double-ceramic-layer EB-PVD thermal barrier coatings annealed at 1,300 °C under ambient isothermal conditions In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 45 (10), 879-893, 2014 [DOI: 10.1002/mawe.201400248] | Bobzin, Kirsten Bagcivan, Nazlim Brögelmann, Tobias Yildirim, Baycan (Corresponding author) |
Investigations of laser clad, thermal sprayed and laser remelted AlSi20-coatings on magnesium alloy AZ31B under constant and cycling thermal load In: Surface & coatings technology, 259 (Pt. C), 751-758, 2014 [DOI: 10.1016/j.surfcoat.2014.09.049] | Rolink, Gesa (Corresponding author) Weisheit, Andreas Biermann, Tim Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Schulz, Christiane Kelbassa, Ingomar |
Einfluss der Wärmebehandlung auf Mikrostruktur und thermophysikalische Eigenschaften von Plasma gespritzten ZrO2-7%Y2O3- und La2Zr2O7-Schichten In: Thermal spray bulletin, 7 (1), 43-49, 2014 | Bobzin, Kirsten Linke, Thomas Frederik Zhao, Lidong Erdogan, Garip Üstel, Fatih Öte, Mehmet |
Emissions in Thermal Spraying : Development of a Suitable Test Method and Evaluation of Measurements in Laboratory as well as in Industrial Scale In: Thermal spray bulletin, 7 (2), 136-141, 2014 | Bobzin, Kirsten Öte, Mehmet Linke, Thomas Frederik Dott, Wolfgang Möller, Manfred |
Erforschung Ti-Co-basierter, bioaktiver Auftraglötschichten auf oxidischen Hochleistungskeramiken in der Medizintechnik In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 45 (6), 504-511, 2014 [DOI: 10.1002/mawe.201400268] | Bobzin, Kirsten Kopp, Nils Wiesner, Stefanie Puidokas, Sabrina Michelle Samadian Anavar, Sharareh (Corresponding author) Fischer, Horst Korsten, Anne Schickle, Karolina |
Microstructure and high-temperature oxidation behavior of wire-arc sprayed Fe-based coatings In: Surface & coatings technology, 251, 186-190, 2014 [DOI: 10.1016/j.surfcoat.2014.04.024] | Li, Ran (Corresponding author) Zhou, Zheng He, Dingyong Zhao, Lidong Song, Xiaoyan |
Correlation between Chemical Glass Components and the Glass Sticking on Sputtered PtIr Physical Vapour Deposition Coatings for Precision Blank Moulding In: Materials Sciences and Applications : MSA, 5, 316-329, 2014 [DOI: 10.4236/msa.2014.55037] | Bobzin, Kirsten Bagcivan, Nazlim Brögelmann, Tobias Münstermann, Tobias |
Plastic flow behavior of (Cr, Al) N hard coatings in dependence of strain rate and nanostructure In: Thin solid films, 556, 390-394, 2014 [DOI: 10.1016/j.tsf.2014.01.069] | Perne, Jan (Corresponding author) |
Influence of Ar/Kr ratio and pulse parameters in a Cr-N high power pulse magnetron sputtering process on plasma and coating properties In: Journal of vacuum science & technology / A, Vacuum, surfaces, & films, 32 (2), 021513, 2014 [DOI: 10.1116/1.4865917] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Trieschmann, Jan Brugnara, Ricardo H. (Corresponding author) Preissing, Sven Hecimovic, Ante |
Wide Gap Active Brazing of Ceramic-to-Metal-Joints for High Temperature Applications In: Frontiers of mechanical engineering in China, 9 (1), 71-74, 2014 [DOI: 10.1007/s11465-014-0291-0] | Bobzin, Kirsten Zhao, Lidong (Corresponding author) Kopp, Nils Samadian Anavar, Sharareh |
Systematische Untersuchung der Eigenschaften gelöteter Fügeverbunde mit anwendungsrelevanten Prüfverfahren In: Schweißen und Schneiden, 65 (5), 254-261, 2013 | Bobzin, Kirsten Kopp, Nils Puidokas, Sabrina Michelle Tillmann, Wolfgang Wojarski, Lukas Liu, C. Manka, Matthias |
Einsatz von PVD-Beschichtungen zur Verschleißreduzierung im tribologischen System Pumpe In: Tribologie und Schmierungstechnik, 61, 5-13, 2013 | Bobzin, Kirsten (Corresponding author) Bagcivan, Nazlim Brögelmann, Tobias Sauter, K. Wegener, T. |
Einfluss von Lot- und Grundwerkstoffen auf die Porosität mittels "Reactive Air Brazing" gelöteter Keramik-Keramik- und Keramik-Metall-Verbindungen In: Schweissen und Schneiden, 65 (12), 838-842, 2013 | Bobzin, Kirsten Kopp, Nils Wiesner, Stefanie |
Wear and high-temperature corrosion behavior of a wire-arc sprayed NiCrB coating In: Thermal spray bulletin, 2013 (1), 48, 2013 | Zhou, Z. Bobzin, Kirsten He, D. Y. Zhao, Lidong Zhao, X. Z. Kopp, Nils Zhao, Q. Y. Li, R. S. |
Surface chemistry of PVD (Cr,Al)N coatings deposited by means of direct current and high power pulsed magnetron sputtering In: Surface and interface analysis : Sia, 45 (13), 1884-1892, 2013 [DOI: 10.1002/sia.5336] | Kunze, Christian Brugnara, Ricardo H. Bagcivan, Nazlim Bobzin, Kirsten Grundmeier, Guido (Corresponding author) |
Influence of temperature on phase stability and thermal conductivity of single- and double-ceramic-layer EB-PVD TBC top coats consisting of 7YSZ, Gd2Zr2O7 and La2Zr2O7 In: Surface & coatings technology, 237, 56-64, 2013 [DOI: 10.1016/j.surfcoat.2013.08.013] | Bobzin, Kirsten Bagcivan, Nazlim Brögelmann, Tobias Yildirim, Baycan (Corresponding author) |
Continuum and kinetic simulations of the neutral gas flow in an industrial physical vapor deposition reactor In: Surface & coatings technology, 237, 176-181, 2013 [DOI: 10.1016/j.surfcoat.2013.08.018] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Brugnara, Ricardo H. Schäfer, Marcel Pascal Brinkmann, Ralf Peter Mussenbrock, Thomas Trieschmann, Jan (Corresponding author) |
Influence of Application Technology on the Erosion Resistance of DLC coatings In: Surface & coatings technology, 237, 284-291, 2013 [DOI: 10.1016/j.surfcoat.2013.07.043] | Depner-Miller, U. (Corresponding author) Ellermeier, J. Scheerer, H. Oechsner, Matthias Bobzin, Kirsten Bagcivan, Nazlim Brögelmann, Tobias Weiss, R. Durst, K. Schmid, C. |
Influence of HPPMS pulse length and inert gas mixture on the properties of (Cr,Al)N coatings In: Thin solid films, 549, 192-198, 2013 [DOI: 10.1016/j.tsf.2013.06.036] | Bagcivan, Nazlim Bobzin, Kirsten Grundmeier, G. Wiesing, M. Ozcan, O. Kunze, C. Brugnara, Ricardo H. (Corresponding author) |
Flow curve determination of thin films by improved finite element models and different nanoindenter geometries In: Thin solid films, 549, 313-320, 2013 [DOI: 10.1016/j.tsf.2013.06.037] | Bobzin, Kirsten Bagcivan, N. Brugnara, R. H. Perne, J. (Corresponding author) |
Vereinfachte Berechnung der Mikrostruktur zur Ableitung der Schichteigenschaften im thermischen Spritzen In: Jahrbuch Oberflächentechnik, 69, 139-154, 2013 | Bobzin, Kirsten Kopp, Nils Linke, Thomas Frederik Schäfer, Marcel Pascal |
Investigation of the Properties of Low Temperature (Cr1-xAlx)N Coatings Deposited via Hybrid PVD DC-MSIP/HPPMS In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (8), 667-672, 2013 [DOI: 10.1002/mawe.201300173] | Bobzin, Kirsten Bagcivan, Nazlim Brugnara, Ricardo H. (Corresponding author) |
Approach to determine stress strain curves by FEM supported nanoindentation In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (6), 571-576, 2013 [DOI: 10.1002/mawe.201300099] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Brugnara, Ricardo H. Perne, Jan (Corresponding author) |
Thermal stability of silicon-doped Al2O3 PVD coatings In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (8), 679-683, 2013 [DOI: 10.1002/mawe.201300175] | Bobzin, Kirsten Bagcivan, Nazlim Müller, M. Ewering, Mara Therese Brugnara, Ricardo H. (Corresponding author) |
Development and qualification of a MSIP PVD iridium coating for precision glass moulding In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 44 (8), 673-678, 2013 [DOI: 10.1002/mawe.201300174] | Bobzin, Kirsten Bagcivan, Nazlim Brögelmann, Tobias Münstermann, Tobias (Corresponding author) |
Improvement of Coating Properties in Three-Cathode Atmospheric Plasma Spraying In: Journal of thermal spray technology : JTST, 22 (4), 502-508, 2013 [DOI: 10.1007/s11666-013-9902-2] | Bobzin, Kirsten Kopp, Nils Warda, Thomas Petkovic, Ivica Zimmermann, S. (Corresponding author) Hartz-Behrend, K. Landes, K. Forster, G. Kirner, S. Marqués, J.-L. Schein, J. Prehm, J. (Corresponding author) Möhwald, K. Bach, Fr.-W. |
Synthesis of nano-structured HPPMS CrN/AlN coatings In: Journal of physics / D, Applied physics, 46 (8), 084001, 2013 [DOI: 10.1088/0022-3727/46/8/084001] | Bagcivan, Nazlim Bobzin, Kirsten Theiß, Sebastian |
Flow curve determination on dc-MS and HPPMS CrAlN coatings In: Journal of physics / D, Applied physics, 46 (8), 084006, 2013 [DOI: 10.1088/0022-3727/46/8/084006] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Perne, Jan (Corresponding author) |
Particle In-Flight and Coating Properties of Fe-Based Feedstock Materials Sprayed with Modern Thermal Spray Systems In: Journal of thermal spray technology : JTST, 22 (2/3), 363-370, 2013 [DOI: 10.1007/s11666-012-9853-z] | Bobzin, Kirsten Kopp, Nils Warda, Thomas (Corresponding author) Petkovic, Ivica Schaefer, Marcel Landes, Klaus Forster, Günter Zimmermann, Stephan Marques, Jose-Luis Kirner, Stefan Kauffeldt, Marina Schein, Jochen |
(Cr1-xAlx)N : A comparison of direct current, middle frequency pulsed and high power pulsed magnetron sputtering for injection molding components In: Thin solid films, 528, 180-186, 2013 [DOI: 10.1016/j.tsf.2012.08.056] | Bagcivan, Nazlim Bobzin, Kirsten Theiß, Sebastian (Corresponding author) |
Behavior of DLC coated low-alloy steel under tribological and corrosive load : Effect of top layer and interlayer variation In: Surface & coatings technology, 215, 110-118, 2013 [DOI: 10.1016/j.surfcoat.2012.08.075] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Weiß, Raphael (Corresponding author) Depner, Udo Trossmann, Torsten Ellermeier, Jörg Oechsner, Matthias |
Stellenwert des Plasmaspritzens unter den thermischen Spritzverfahren In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 103 (11), 2384-2395, 2012 | Bobzin, Kirsten Warda, Thomas Brühl, Markus |
Improving Contour Accuracy and Strength of Reactive Air Brazed (RAB) Ceramic/Metal Joints by Controlling Interface Microstructure In: Advanced engineering materials, 14 (6), 394-399, 2012 [DOI: 10.1002/adem.201100274] | Li, Chichi Kuhn, Bernd Brandenberg, Jörg Beck, Tilmann Singheiser, Lorenz Bobzin, Kirsten Bagcivan, Nazlim Kopp, Nils |
Feasibility study of plasma sprayed Al2O3 coatings as diffusion barrier on CFC components In: Frontiers of Mechanical Engineering, 7 (4), 371-375, 2012 [DOI: 10.1007/s11465-012-0339-y] | Bobzin, Kirsten Zhao, Lidong Kopp, Nils Warda, Thomas |
Thermisch gespritzte Korrosionsschutzschichten auf Zink-Basis als Ergänzung zum Stückverzinken von Bauteilen In: Thermal spray bulletin, 5 (1), 48-55, 2012 | Bobzin, Kirsten Kopp, Nils Warda, Thomas Schulz, Christiane Klesen, Christian Poller, Benjamin Ingendahl, Tobias |
Determination of the Effective Properties of Thermal Spray Coatings Using 2D and 3D Models In: Journal of thermal spray technology : JTST, 21 (6), 1269-1277, 2012 [DOI: 10.1007/s11666-012-9809-3] | Bobzin, Kirsten Kopp, Nils Warda, Thomas Öte, Mehmet |
Extrusion embossing of hydrophobic films - a study on process characteristics and surface properties In: Zeitschrift Kunststofftechnik = Journal of plastics technology, 8 (3), 302-330, 2012 | Hopmann, Christian Michaeli, Walter Eilbracht, Stephan Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Hartmann, Claudia Holtkamp, Jens Gillner, Arnold Mayer, Joachim |
Investigation of wear and corrosion protection of AlSi20 coatings produced by thermal spraying and laser cladding on AZ31B In: Journal of thermal spray technology : JTST, 22 (2/3), 207-212, 2012 [DOI: 10.1007/s11666-012-9867-6] | Bobzin, Kirsten Kopp, Nils Warda, Thomas Schulz, Christiane (Corresponding author) Rolink, Gesa Weisheit, Andreas |
Comparison of (Cr0.75Al0.25)N Coatings Deposited by Conventional and High Power Pulsed Magnetron Sputtering In: Contributions to plasma physics : CPP, 52 (7), 601-606, 2012 [DOI: 10.1002/ctpp.201210056] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian |
Influence of interlayer thickness of a thin noble metal MSIP-PVD coating on compound and system properties for glass lens moulding In: Production engineering, 6 (3), 311-318, 2012 [DOI: 10.1007/s11740-012-0385-7] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Brugnara, Ricardo H. Münstermann, Tobias |
Vanadium Alloyed PVD CrAlN Coatings for Friction Reduction in Metal Forming Applications In: Tribology in Industry, 34 (2), 101-107, 2012 | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Brugnara, Ricardo H. |
Influence of the Layer Architecture of DLC Coatings on their Wear and Corrosion Resistance In: International journal of materials research : IJMR, 103 (6), 774-782, 2012 [DOI: 10.3139/146.110763] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Weiß, Raphael Troßmann, Torsten Ellermeier, Jörg Oechsner, Matthias Depner, Udo |
Kraftstoffersparnis durch Hochleistungswerkstoffe In: Vakuum in Forschung und Praxis : VIP, 24 (2), 35-38, 2012 [DOI: 10.1002/vipr.201200487] | Bobzin, Kirsten Bagcivan, Nazlim Verpoort, Clemens Schramm, Leander Yilmaz, Koray Theiß, Sebastian (Corresponding author) |
Development of an integrative simulation method to predict the microstructural influence on the mechanical behaviour of semi-crystalline thermoplastic parts In: International journal of materials research : IJMR, 103 (1), 120-130, 2012 [DOI: 10.3139/146.110628] | Michaeli, Walter Hopmann, Christian Bobzin, Kirsten Arping, Tim Wilhelm Baranowski, Thomas Heesel, Barbara Laschet, Gottfried Schläfer, Thomas Öte, Mehmet |
Application of variothermal heating concepts for the production of micro-structured films using the extrusion embossing process In: Journal of polymer engineering, 32 (2), 95-101, 2012 [DOI: 10.1515/polyeng-2012-0502] | Michaeli, Walter Eilbracht, Stephan Scharf, Micha Christian Hartmann, Claudia Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian |
Ultrasonic welding of hybrid metal-plastic components with flame spraying of adhesion layer In: Zeitschrift Kunststofftechnik, 7, 161-177, 2011 | Flock, Dustin (Corresponding author) Haberstroh, Edmund Bobzin, Kirsten Schläfer, Thomas Warda, Thomas Kutschmann, Pia |
Development of oxide based diffusion barrier coatings for CFC components applied in modern furnaces In: Frontiers of Mechanical Engineering, 6 (4), 392-396, 2011 [DOI: 10.1007/s11465-011-0241-z] | Bobzin, Kirsten Zhao, Lidong Schläfer, Thomas Warda, Thomas |
HPPMS coatings for metal deformation tools In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 102 (5), 1150-1157, 2011 | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Brugnara, Ricardo H. |
Preparation and characterization of nanocrystalline ZrO2-7%Y2O3 powders for thermal barrier coatings by high-energy ball milling In: Frontiers of Mechanical Engineering, 6 (2), 176-181, 2011 [DOI: 10.1007/s11465-011-0220-4] | Bobzin, Kirsten Zhao, Lidong Schläfer, Thomas Warda, Thomas |
Crystalline γ-Al2O3 Physical Vapour Deposition-Coating for Steel Thixoforging Tools In: Journal of nanoscience and nanotechnology, 11 (10), 8782-8785, 2011 [DOI: 10.1166/jnn.2011.3469] | Bobzin, Kirsten Hirt, Gerhard Bagcivan, Nazlim Khizhnyakova, Liudmila Ewering, Mara Therese |
Improving Long Term Oxidation Protection for Gamma-TiAl Substrates In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 42 (11), 1013-1018, 2011 [DOI: 10.1002/mawe.201100827] | Bobzin, Kirsten Linke, Thomas Frederik Brühl, Markus Warda, Thomas Schläfer, Thomas |
Optimisation of an HVOF process using simulation techniques In: Thermal spray bulletin, 2, 159-164, 2011 | Bobzin, Kirsten Schläfer, Thomas Schäfer, Marcel Pascal |
Wear behavior of HPPMS deposited (Ti,Al,Si)N coating under impact loading In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 42 (3), 165-171, 2011 [DOI: 10.1002/mawe.201100771] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Theiß, Sebastian |
Hydrogen content variation for enhancing the lubricated tribological performance of DLC coatings with ester In: Surface & coatings technology, 205 (Suppl. 2), 89-93, 2011 [DOI: 10.1016/j.surfcoat.2011.02.065] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Yilmaz, Koray |
Die Entwicklung des Breitspaltaktivlötens als neue Fügetechnologie für Keramik-Metall-Mischverbunde mit Einsatztemperaturen oberhalb 500 °C In: Keramische Zeitschrift, 63 (5), 329-333, 2011 | Schlegel, Arne Bobzin, Kirsten Kopp, Nils Bagcivan, Nazlim |
Thermochemistry of brazing ceramics and metals in air In: International journal of materials research : IJMR, 8 (08), 972-976, 2011 [DOI: 10.3139/146.110550] | Bobzin, Kirsten Schläfer, Thomas Kopp, Nils |
Nachbearbeitungsarme Fe-Basis-Feinstpulverschichtenzum kostengünstigen Korrosionsund Verschleißschutz In: Thermal spray bulletin, 4 (2), 139-146, 2011 | Bobzin, Kirsten Schläfer, Thomas Warda, Thomas Schäfer, Marcel Pascal |
Injection molding of products with functional surfaces by micro-structured, PVD coated injection molds In: Production engineering, 5 (4), 415-422, 2011 [DOI: 10.1007/s11740-011-0319-9] | Bobzin, Kirsten Bagcivan, Nazlim Gillner, Arnold Hartmann, Claudia Holtkamp, Jens Michaeli, Walter Klaiber, Fritz Schöngart, Maximilian Theiß, Sebastian |
PVD-beschichteteWälzlager im Trockenlauf In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 42 (11), 1025-1034, 2011 [DOI: 10.1002/mawe.201100847] | Jacobs, Georg Rombach, Volker Plogmann, Michael van Lier, Hermann Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Weiß, Raphael (Corresponding author) |
In-Vitro Study of Microplasma Sprayed Hydroxyapatite Coatings in Hanks Balanced Salt Solution In: Materials and manufacturing processes, 26 (2), 175-180, 2011 [DOI: 10.1080/10426914.2010.498071] | Zhao, Qiuying He, Dingyong Zhao, Lidong Li, Xiaoyan |
Replication of specifially microstructured surfaces in A356-alloy via lost wax investment casting In: Journal of micromechanics and microengineering, 21 (8), 085026, 2011 [DOI: 10.1088/0960-1317/21/8/085026] | Ivanov, Todor Bührig-Polaczek, Andreas Vroomen, Uwe Hartmann, Claudia Holtkamp, Jens Gillner, Arnold Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian |
Numerical and experimental determination of plasma temperature during air plasma spraying with a multiple cathodes torch In: Journal of materials processing technology, 211 (10), 1620-1628, 2011 [DOI: 10.1016/j.jmatprotec.2011.05.001] | Bobzin, Kirsten Bagcivan, Nazlim Petkovic, Ivica |
Modelling and diagnostics of multiple cathodes plasma torch system for plasma spraying In: Frontiers of Mechanical Engineering, 6 (3), 324-331, 2011 [DOI: 10.1007/s11465-011-0125-2] | Bobzin, Kirsten Bagcivan, Nazlim Zhao, Lidong Petkovic, Ivica Schein, Jochen Hartz-Behrend, Karsten Kirner, Stefan Marqués, José-Luis Forster, Günter |
DC-MSIP/HPPMS (Cr,Al,V)N and (Cr,Al,W)N thin films for high-temperature friction reduction In: Surface & coatings technology, 205 (8/9), 2887-2892, 2011 [DOI: 10.1016/j.surfcoat.2010.10.056] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Brugnara, Ricardo H. Theiß, Sebastian |
A Strong Connection of Unequal Partners [Joining method ] In: Kunststoffe / Kunststoffe international, 100 (11), 50-53, 2010 | Flock, Dustin Haberstroh, Edmund Rosner, A. Gillner, Arnold Poprawe, N. R. Theiß, Sebastian Bagcivan, Nazlim Bobzin, Kirsten Wagner, Nikolaus Olschok, Simon Reisgen, Uwe |
Characterisation of plasma-sprayed SrFe12O19 coatings for electromagnetic wave absorption In: Journal of the European Ceramic Society, 31 (8), 1439-1449, 2010 [DOI: 10.1016/j.jeurceramsoc.2011.02.003] | Bobzin, Kirsten Bolelli, Giovanni Brühl, Markus Hujanen, Arto Lintunen, Pertti Lisjak, Darja Gyergyek, Sašo Lusvarghi, Luca |
Entwicklung von neuen Aktivlotpulvern auf Basis kommerzieller Nickellote mit Zirkon als Aktivelement zum Fügen von Keramik-Metall-Verbunden In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 41 (6), 455-463, 2010 [DOI: 10.1002/mawe.201000627] | Bobzin, Kirsten Schläfer, Thomas Kopp, Nils Schlegel, Arne |
Deposition of High-Quality NiCoCrAlTaReSiY Oxidation Resistance Coatings by HVOF In: Xiyou-jinshu-cailiao-yu-gongcheng = Rare metal materials and engineering, 39 (11), 2027-2029, 2010 | Wang, Kaisheng Zhao, Lidong Zhao, Zhimin |
Systematische Untersuchung der Verbindungseigenschaften von Lötungen mit Ag-, Cu-, Au- und Ni-Basisloten mit anwendungsrelevanten Prüfverfahren In: Schweissen und Schneiden, 62 (5), 256-263, 2010 | Bobzin, Kirsten Schläfer, Thomas Kopp, Nils Puidokas, Sabrina Michelle Tillmann, Walter Osmanda, Artur Martin Wojarski, Lukas |
Untersuchung und Bewertung der Fehlergrößen im Haftzugversuch nach DIN EN 582 In: Thermal spray bulletin, 3 (1), 30-36, 2010 | Bobzin, Kirsten Schläfer, Thomas Aumund-Kopp, Claus |
Calculation of effective properties of textile reinforced aluminum alloy by a two-step homogenization procedure In: Computational materials science, 47 (3), 801-806, 2010 [DOI: 10.1016/j.commatsci.2009.11.007] | Bobzin, Kirsten Bagcivan, Nazlim Parkot, Daniel Kashko, Tatyana |
Hexaferrite/Polyester Composite Coatings for Electromagnetic-Wave Absorbers In: Journal of thermal spray technology : JTST, 20 (3), 638-644, 2010 [DOI: 10.1007/s11666-010-9607-8] | Lisjak, Darja Bégard, Marion Brühl, Markus Bobzin, Kirsten Hujanen, Arto Lintunen, Pertti Bolelli, Giovanni Lusvarghi, Luca Ovtar, Simona Drofenik, Miha |
HPPMS-Beschichtung für Umformwerkzeuge In: Jahrbuch Oberflächentechnik, 66, 88-95, 2010 | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Brugnara, Ricardo H. |
Impact Behaviour of PtIr-based Coatings with Different Interlayers for Glass Lens Moulding In: Key engineering materials, 438, 57-64, 2010 [DOI: 10.4028/www.scientific.net/KEM.438.57] | Bobzin, Kirsten Klocke, Fritz Bagcivan, Nazlim Ewering, Mara Therese Georgiadis, Kyriakos Münstermann, Tobias |
Thermal stability of [gamma]-Al2O3 coatings for challenging cutting operations In: Surface & coatings technology, 205 (5), 1444-1448, 2010 [DOI: 10.1016/j.surfcoat.2010.07.040] | Bobzin, Kirsten Bagcivan, Nazlim Reinholdt, Alexander Ewering, Mara Therese |
Plasma coatings CrAlN and a-C:H for high efficient power train in automobile In: Surface & coatings technology, 205 (5), 1502-1507, 2010 [DOI: 10.1016/j.surfcoat.2010.08.108] | Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Yilmaz, Koray |
Hartstoffschichten der Zukunft : Oxidische Schichten und HPPMS-Schichten für anspruchsvolle Zerspanaufgaben In: Vakuum in Forschung und Praxis : VIP, 22 (6), 31-35, 2010 [DOI: 10.1002/vipr.201000437] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese |
Metal flow and die wear in semi-solid forging of steel using coated dies In: Transactions of Nonferrous Metals Society of China : english edition, 20 (Supplement 3), 954-960, 2010 [DOI: 10.1016/s1003-6326(10)60613-9] | Khizhnyakova, L. Ewering, Mara Therese Hirt, Gerhard Bobzin, Kirsten Bagcivan, Nazlim |
Influence of the filler materials on flux-free brazing of pure aluminium (1050) In: Frontiers of mechanical engineering in China, 5 (1), 47-51, 2010 [DOI: 10.1007/s11465-009-0079-9] | Bobzin, Kirsten Zhao, Lidong Schläfer, Thomas Warda, Thomas |
Application of cold spraying for flux-free brazing of aluminium alloy 6060 In: Frontiers of mechanical engineering in China, 5 (3), 256-260, 2010 [DOI: 10.1007/s11465-010-0095-9] | Bobzin, Kirsten Zhao, Lidong Schläfer, Thomas Warda, Thomas |
Semi-solid forming of non axis-symmetric parts from steel grade X210CrW12 with PVD coated tools In: International journal of material forming, 3 (1), 731-734, 2010 [DOI: 10.1007/s12289-010-0874-1] | Hirt, Gerhard Bobzin, Kirsten Khizhnyakova, Liudmila Ewering, Mara Therese Bagcivan, Nazlim |
Development of Ba-hexaferrite coatings for electromagnetic wave absorption applications In: Surface & coatings technology, 205 (4), 1015-1020, 2010 [DOI: 10.1016/j.surfcoat.2010.03.060] | Bobzin, Kirsten Schläfer, Thomas Bégard, Marion Brühl, Markus Bolelli, Giovanni Lusvarghi, Luca Lisjak, Darja Hujanen, Arto Lintunen, Pertti Kanerva, Ulla Varis, Tommi Pasquale, Massimo |
Magnetic Phase Formation in CoTi-Substituted Ba Hexaferrite Coatings Prepared with Atmospheric Plasma Spraying In: Journal of the American Ceramic Society, 93 (9), 2579-2584, 2010 [DOI: 10.1111/j.1551-2916.2010.03770.x] | Lisjak, Darja Bolelli, Giovanni Lusvarghi, Luca Bégard, Marion Brühl, Markus Bobzin, Kirsten Lintunen, Pertti Kanerva, Ulla Pasquale, Massimo Drofenik, Miha |
Starke Verbindung ungleicher Partner In: Kunststoffe / [Deutsche Ausgabe], 11 (112), 60-63, 2010 | Flock, Dustin Haberstroh, Edmund Rösner, Andreas Gillner, Arnold Poprawe, Reinhart Theiß, Sebastian Bagcivan, Nazlim Bobzin, Kirsten Wagner, Nikolaus Olschok, Simon Reisgen, Uwe |
Development of PVD coatings for application of zinc die casting In: International foundry research, 62 (10), 8-14, 2010 | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese |
Development of new transient liquid phase system Au-Sn-Au for microsystem technology In: Frontiers of mechanical engineering in China, 5 (4), 370-375, 2010 [DOI: 10.1007/s11465-010-0107-9] | Bobzin, Kirsten Bagcivan, Nazlim Zhao, Lidong Ferrara, Stefania Perne, Jan |
Brazing of ceramic-to-ceramic and ceramic-to-metal joints in air In: Frontiers of mechanical engineering in China, 5 (2), 125-129, 2010 [DOI: 10.1007/s11465-010-0007-z] | Bobzin, Kirsten Schläfer, Thomas Zhao, Lidong Kopp, Nils Schlegel, Arne |
Lotus-Effekt für Massenprodukte : Mikrostrukturierte Kunststoffbauteile durch Abformen eines Werkzeuges herstellen In: Der Plastverarbeiter : PV, 2010 (9), 104-106, 2010 | Bagcivan, Nazlim Bobzin, Kirsten Eilbracht, Stephan Gillner, Arnold Hartmann, Claudia Klaiber, Fritz Michaeli, Walter Scharf, Micha Christian Theiß, Sebastian |
Environmentally friendly tribological systems in axial piston machines In: Tribologie und Schmierungstechnik, 57 (3), 27-31, 2010 | Murrenhoff, Hubertus Enekes, Claus Peter Gold, Peter Werner Jacobs, Georg Rombach, Volker Plogmann, Michael Bobzin, Kirsten Bagcivan, Nazlim Theiß, Sebastian Göbbels, Nico |
Influence of different pulse parameters on the deposition of Al2O3 In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 41 (8), 670-674, 2010 [DOI: 10.1002/mawe.201000653] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese |
Hot Forging of C45 using PVD (Ti,Al)N/γ-Al2O3 Coated Dies In: Steel research international, 81 (7), 603-609, 2010 [DOI: 10.1002/srin.201000031] | Bobzin, Kirsten Hirt, Gerhard Springorum, F. Zitz, U. Steinhof, N. Bagcivan, Nazlim Baadjou, René Ewering, Mara Therese Immich, Philipp |
Development of NiZn-Ferrite Coatings for Electromagnetic Applications In: Welding and cutting, 9 (2), 111-116, 2010 | Talaka, Tatiana Ilyuschencko, Alexander Weil, Carsten Linden, Ismo McCartney, Graham Zhang, Deen Yellup, John Y. Brühl, Markus Bobzin, Kirsten |
Understanding HPPMS PVD In: Europhysics news, 41 (3), 14-15, 2010 | Theiß, Sebastian Bibinov, N. Bagcivan, Nazlim Ewering, Mara Therese Awakowicz, Peter Bobzin, Kirsten |
Time resolved optical emission spectroscopy of an HPPMS coating process In: Journal of physics / D, Applied physics, 43 (7), 8-8, 2010 [DOI: 10.1088/0022-3727/43/7/075205] | Theiß, Sebastian Bibinov, Nikita Bagcivan, Nazlim Ewering, Mara Therese Awakowicz, Peter Bobzin, Kirsten |
Microstructure and complex magnetic permeability of thermally sprayed NiZn ferrite coatings for electromagnetic wave absorbers In: Surface engineering, 26 (6), 484-490, 2010 [DOI: 10.1179/026708410X12687356948634] | Brühl, Markus Zhang, Deen Talaka, Tatiana Weil, Carsten Linden, Ismo Bobzin, Kirsten Ilyuschencko, Alexander McCartney, Graham Yellup, John Y. |
Crystalline γ-Alumina Deposited in an Industrial Coating Unit for Demanding Turning Operations In: Advanced engineering materials, 12 (1/2), 75-79, 2010 [DOI: 10.1002/adem.200900232] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese |
Modeling of Coating Process, Phase Changes, and Damage of Plasma Sprayed Thermal Barrier Coatings on Ni-Base Superalloys In: Advanced engineering materials, 12 (3), 110-126, 2009 [DOI: 10.1002/adem.201000023] | Beck, Tilmann Bialas, Marcin Bednarz, Piotr Singheiser, Lorenz Bobzin, Kirsten Bagcivan, Nazlim Parkot, Daniel Kashko, Tatyana Petkovic, Jvica Hallstedt, Bengt Nemna, Sergey Schneider, Jochen M. |
Simulation of PYSZ particle impact and solidification in atmospheric plasma spraying coating process In: Surface & coatings technology, 204 (8), 1211-1215, 2010 [DOI: 10.1016/j.surfcoat.2009.10.028] | Bobzin, Kirsten Bagcivan, Nazlim Parkot, Daniel Petkovic, Ivica |
Microstructure and properties of HVOF sprayed AP40 bioactive glass-ceramic coatings In: Beijing-Gongye-Daxue-xuebao : jikan = Journal of Beijing University of Technology, 35 (3), 374-377, 2009 | Ding-Yong, He Li-Dong, Zhao |
Modified plastic surfaces for growth of adherent cells, localized genetic modification and cell selection In: Human gene therapy, 20 (11), 1436-1436, 2009 | Meyring, Wilhelm Schoen, Oliver Zghoul, Nadia Pohl, Susanne Dohse, Antje Thomas, Michael Garritsen, Henk Woermann, Bernhard Dittmar, Kurt Lindenmaier, Werner |
Impact behavior of (Ti,Al,Si)N deposited by HPPMS In: Thin solid films, 518 (5), H2-2-7, 2009 | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Theiß, Sebastian Bolz, Stephan Frédéric |
Crystalline y-Al2O3 Coating for Steel Thixoforging Tools In: Journal of nanoscience and nanotechnology, 9 (Special issue), 2009 | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Khizhnyakova, Luidmila |
Challenging gold based filler metals for uses in medicine In: Materials science and technology : MST, 25 (12), 1422-1431, 2009 [DOI: 10.1179/174328407X226590] | Bobzin, Kirsten Lugscheider, Erich Ernst, F. Rösing, J. Ferrara, S. |
Entwicklung von Diffusionssperrschichten für CFC-Bauteile mittels thermischer Spritztechnik In: Thermal spray bulletin, 2 (1), 34-38, 2009 | Bobzin, Kirsten Zhao, Lidong Schläfer, Thomas Warda, Thomas |
Influence of the definition of the representative volume element on the effective thermoelastic properties of thermal barrier coatings with random microstructure In: Journal of thermal spray technology : JTST, 18 (5/6), 988-995, 2009 [DOI: 10.1007/s11666-009-9351-0] | Bobzin, Kirsten Bagcivan, Nazlim Parkot, Daniel Kashko, Tatyana Laschet, Gottfried Scheele, Josef |
Surface-brazed wear protection systems for titanium alloys In: Welding and cutting, 8 (4), 211-213, 2009 | Bobzin, Kirsten Ernst, Felix Björn Gustav Schlegel, Arne Kopp, Nils |
Skalenübergreifende Simulation teilkristalliner Thermoplaste In: Werkstoffe in der Fertigung : die Fachzeitschrift für technische Führungskräfte, 2009 (5), 33-34, 2009 | Michaeli, Walter Baranowski, Thomas Heesel, Barbara Bobzin, Kirsten Kashko, Tatyana Parkot, Daniel Bagcivan, Nazlim |
Effect of the Substrate Geometry on Plasma Synthesis of DLC Coatings In: Plasma processes and polymers, 6.2009 (6/7), 425-S428, 2009 [DOI: 10.1002/ppap.200931010] | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico Yilmaz, Koray |
Effect of heat treatment on the microstructure and mechanical properties of Fe-based amorphous coatings In: Journal of alloys and compounds : JAL, 480 (2), 422-427, 2009 [DOI: 10.1016/j.jallcom.2009.02.107] | Fu, Bin-you He, Ding-yong Zhao, Lidong |
Microstructure characterisation and wear properties of arc sprayed NiB containing amorphous coatings In: Surface engineering, 25 (4), 326-332, 2009 [DOI: 10.1179/026708409X364966] | Fu, Bin-you He, Ding-Yong Zhao, Lidong Li, X. Y. |
Microstructure and properties of arc sprayed coatings containing Fe based amorphous phase and nanocrystallites In: Surface engineering, 25 (4), 333-337, 2009 [DOI: 10.1179/026708409X396060] | Fu, Bin-You He, Ding-Yong Zhao, Lidong Jiang, J. M. Li, X.Y. |
Arc Ion Plating Process Monitoring by Optical Emission Spectroscopy Exemplified for Chromium Containing Coatings In: Plasma processes and polymers, 6.2009 (6/7), S357-S361, 2009 [DOI: 10.1002/ppap.200930806] | Bobzin, Kirsten Bagcivan, Kirsten Immich, Philipp Theiß, Sebastian |
Investigation of Properties and Wear Behavior of HVOF Sprayed TiC-Strengthened Fe Coatings In: Journal of thermal spray technology : JTST, 18 (4), 672-677, 2009 [DOI: 10.1007/s11666-009-9384-4] | Bobzin, Kirsten Schläfer, Thomas Richardt, Katharina Rebecca Maria Warda, Thomas Reisel, Guido |
Modeling and Simulation of Microstructure Formation for Porosity Prediction in Thermal Barrier Coatings Under Air Plasma Spraying Condition In: Journal of thermal spray technology : JTST, 18 (5), 975-980, 2009 [DOI: 10.1007/s11666-009-9340-3] | Bobzin, Kirsten Bagcivan, Nazlim Parkot, Daniel Schäfer, Marcel Pascal Petkovic, Ivica |
Lubricated PVD CrAlN and WC/C coatings for automotive applications In: Surface & coatings technology, 204 (6/7), 1097-1101, 2009 [DOI: 10.1016/j.surfcoat.2009.07.045] | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico Yilmaz, Koray Höhn, Bernd-Robert Michaelis, Klaus Hochmann, Michael |
Development of NiZn-ferrite coatings for electromagnetic applications In: Thermal spray bulletin, 2 (2), 126-132, 2009 | Talaka, Tatiana Ilyuschencko, Alexander Weil, Carsten Linden, Ismo McCartney, Graham Zhang, Deen Yellup, John Y. Brühl, Markus Bobzin, Kirsten |
Detektion von Verunreinigungen beim bleifreien Wellen- und Selektivlöten und deren Auswirkungen auf die Lötstelle In: Schweissen und Schneiden, 61 (7), 358-368, 2009 | Bach, Friedrich-Wilhelm Möhwald, Kai Schaup, Jörg Holländer, Ulrich Herzog, Thomas Wohlrabe, Heinz Wielage, Bernhard Lampke, Thomas Weber-Nester, Daisy Bobzin, Kirsten |
PVD Beschichtung von Polyetheretherketon (PEEK) zur Verschleiß- und Reibungsminimierung im Kontakt Käfig-Führungsbord eines Spindellagers In: Tribologie und Schmierungstechnik, 56, 11-15, 2009 | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico |
Properties of (Ti,Al,Si)N coatings for high demanding metal cutting applications deposited by HPPMS in an industrial coating unit In: Plasma processes and polymers, 6.2009 (6/7), S124-128, 2009 [DOI: 10.1002/ppap.200930408] | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Bolz, Stephan Frédéric Fuß, Hans-Gerd Cremer, Rainer |
Preparation of barium hexaferrite coatings using atmospheric plasma spraying In: Journal of the European Ceramic Society, 29 (11), 2333-2341, 2009 [DOI: 10.1016/j.jeurceramsoc.2009.01.028] | Lisjak, Darja Bobzin, Kirsten Richardt, Katharina Rebecca Maria Bégard, Marion Bolelli, Giovanni Lusvarghi, Luca Hujanen, Arto Lintunen, Pertti Pasquale, Massimo Olivetti, Elena Drofenik, Miha Schläfer, Thomas |
Wiederaufarbeitung von Motorzylinderbohrungen durch Spritzreparatur unter Anwendung des PTWA-Verfahrens (Plasma Transferred Wire Arc) In: Thermal spray bulletin, 2 (1), 26-31, 2009 | Bobzin, Kirsten Schläfer, Thomas Beardsley, Brad Gerke, Dan Sharp, Bob Blume, Fritz Silk, Mark Schramm, Leander Schwenk, Alexander Lindon, Spencer |
Entwicklung von eisenbasierten Spritzzusatzwerkstoffen und deren Verarbeitung durch Lichtbogenspritzen In: Thermal spray bulletin, 2 (1), 58-63, 2009 | Bobzin, Kirsten Zhao, Lidong Schläfer, Thomas Kutschmann, Pia |
Eigenschaftsoptimierung eines niedriglegierten Stahls mittels PVD- (Physical Vapour Deposition) Technologie In: Jahrbuch Oberflächentechnik, 65, 103-108, 2009 | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico Weiß, Raphael |
Investigations on nanolaminated TiZrN/CrN as a tribological PVD hard coating for incremental sheet forming tools In: Advanced engineering materials, 11 (8), 674-679, 2009 [DOI: 10.1002/adem.200900088] | Bobzin, Kirsten Bagcivan, Nazlim Ewering, Mara Therese Warnke, Carsten |
Thermal investigation of Al2O3 thin films for application in cutting operations In: Advanced engineering materials, 11 (7), 590-594, 2009 [DOI: 10.1002/adem.200800421] | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Ewering, Mara Therese |
High power pulsed magnetron sputtering: fundamentals and applications In: Journal of alloys and compounds : JAL, 483.2009 (1/2), 530-534, 2009 [DOI: 10.1016/j.jallcom.2008.08.104] | Alami, Jones Bolz, Stephan Frédéric Sarakinos, Kostas |
Thermal spraying of Co,Ti-substituted Ba-hexaferrite coatings for electromagnetic wave absorption applications In: Surface & coatings technology, 203 (20/21), 3312-3319, 2009 [DOI: 10.1016/j.surfcoat.2009.04.007] | Bégard, Marion Bobzin, Kirsten Bolelli, Giovanni Hujanen, Arto Lintunen, Pertti Lisjak, Darja Gyergyek, Sašo Lusvarghi, Luca Pasquale, Massimo Richardt, Katharina Rebecca Maria Schläfer, Thomas Varis, Tommi |
Hybridprozessentwicklung zur Plasmasynthese temperaturbeständiger Kohlenstoffschichten In: WING, 2009, 2009 | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Yilmaz, Koray |
Advancement of a nanolaminated TiHfN/CrN PVD tool coating by a nano-structured CrN top layer in interaction with a biodegradable lubricant for green metal forming In: Surface & coatings technology, 203 (20/21), 3184-3188, 2009 [DOI: 10.1016/j.surfcoat.2009.03.053] | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Warnke, Carsten Klocke, Fritz Zeppenfeld, Christoph Mattfeld, Patrick |
Advantages of nanocomposite coatings deposited by high power pulse magnetron sputtering technology In: Journal of materials processing technology, 209 (1), 165-170, 2009 [DOI: 10.1016/j.jmatprotec.2008.01.035] | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Bolz, Stephan Frédéric Alami, Jones Cremer, Rainer |
Development of a new wear resistant coating by arc spraying of a steel-based cored wire In: Frontiers of mechanical engineering in China, 4 (1), 7-10, 2008 [DOI: 10.1007/s11465-009-0012-2] | Zhao, Lidong Binyou Fu Dingyong He Kutschmann, Pia |
Untersuchung zum flussmittelfreien Löten einer AlMg3-Legierung mit Hilfe der Kaltgasbelotung In: Thermal spray bulletin, 1 (1), 50-54, 2008 | Bobzin, Kirsten Lugscheider, Erich Ernst, Felix Björn Gustav Richardt, Katharina Rebecca Maria Zhao, Lidong |
Neue HPPMS-Technologie - Zerspanwerkzeuge hochpulsig beschichten In: Journal für Oberflächentechnik : JOT, 48 (1), 34-35, 2008 | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Bolz, Stephan Frédéric |
HyDraNo In: WING : das Jahrbuch, 2007, 2008 | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico |
NaCoLab In: WING : das Jahrbuch, 2007, 2008 | Bobzin, Kirsten Ernst, Felix Björn Gustav Schläfer, Thomas Richardt, Katharina Rebecca Maria |
Hybridprozessentwicklung zur Plasmasynthese temperaturbeständiger Kohlenstoffschichten In: WING, 2008, 2008 | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Yilmaz, Koray |
PVD - Eine Erfolgsgeschichte mit Zukunft In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 39 (1), 5-12, 2008 [DOI: 10.1002/mawe.200700252] | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Pinero, Carmen Göbbels, Nico Krämer, Anika |
Zukunftsweisende Werkstoffkombinationen und Beschichtung beliebiger Konturen möglich In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 100 (1), 192-193, 2008 | Bobzin, Kirsten |
Thermisch gespritzte titankarbidverstärkte Eisenbasisschichten als Alternative zu konventionellen karbidischen Werkstoffen In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 39 (1), 13-17, 2008 [DOI: 10.1002/mawe.200700235] | Bobzin, Kirsten Ernst, Felix Björn Gustav Richardt, Katharina Rebecca Maria Warda, Thomas Reisel, Guido |
A look at the development of magnesium-based filler metals In: Welding journal, 87 (3), 38-40, 2008 | Bobzin, Kirsten Lugscheider, Erich Ernst, Felix Björn Gustav Schlegel, Arne Rösing, Jürgen Jäger, Doris |
Developing PVD zirconium-oxide coatings for use of thixoforming of steel In: International journal of microstructure and materials properties : IJMMP, 3 (2/3), 267-270, 2008 [DOI: 10.1504/IJMMP.2008.018733] | Bobzin, Kirsten Lugscheider, Erich Maes, Michael Immich, Philipp |
Mikrostruktur und Eigenschaften lichtbogengespritzter Schichten auf Eisenbasis In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 39 (12), 867-870, 2008 [DOI: 10.1002/mawe.200800393] | Bobzin, Kirsten Schläfer, Thomas Richardt, Katharina Rebecca Maria Zhao, Lidong Kutschmann, Pia |
Coating bores of light metal engine blocks with a nanocomposite material using the plasma transferred wire arc thermal spray process In: Journal of thermal spray technology : JTST, 17 (3), 344-351, 2008 [DOI: 10.1007/s11666-008-9188-y] | Bobzin, Kirsten Ernst, Felix Björn Gustav Zwick, Jochen Bernt Schläfer, Thomas Cook, David Nassenstein, Klaus Schwenk, Alexander Schreiber, Frank Wenz, Thomas Flores, Gerhard Hahn, Mareike |
Solders development and application process for a micro chip-camera In: Microsystem technologies, 14.2008 (12), 1887-1894, 2008 [DOI: 10.1007/s00542-008-0613-4] | Bobzin, Kirsten Lugscheider, Erich Ernst, Felix Björn Gustav Nickel, Reimo Bagcivan, Nazlim Parkot, Daniel Schlegel, Arne Ferrara, Stefania Kashko, Tatyana Leick, Noémi |
Untersuchung des Benetzungsverhaltens von Schmierstoffen auf PVD-beschichteten Oberflächen und dessen Einfluss auf tribologische Eigenschaften In: Tribologie und Schmierungstechnik, 55 (1), 5-9, 2008 | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Yilmaz, Koray |
Untersuchung des Einflusses unterschiedlicher Karbidbildner auf das tribologische Verhalten mittels reaktivem Magnetron-Sputter-Ion-Plating MSIP abgeschiedener Nanocomposite nc-MeC/a-C:H Beschichtungen In: Tribologie und Schmierungstechnik, 55 (2), 5-10, 2008 | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Göbbels, Nico |
Anwendungen von Modellierung und Simulation zur Vorhersage der Spritzpartikel-Morphologie unter APS-Prozessbedingungen In: Thermal spray bulletin, 1 (2), 114-118, 2008 | Bobzin, Kirsten Bagcivan, Nazlim Parkot, Daniel Petkovic, Ivica |
Thermal spraying of cylinder bores with the plasma transferred wire arc process In: Surface & coatings technology, 202 (18), 4438-4443, 2008 [DOI: 10.1016/j.surfcoat.2008.04.023] | Bobzin, Kirsten Ernst, Felix Björn Gustav Richardt, Katharina Rebecca Maria Schläfer, Thomas Verpoort, Clemens Flores, Gerhard |
Qualitätssicherung durch On-Line Prozessdiagnostik In: Schweissen und Schneiden, 60 (2), 84-87, 2008 | Bobzin, Kirsten Ernst, Felix Björn Gustav Zwick, Jochen Bernt Richardt, Katharina Rebecca Maria Landes, Klaus Zierhut, Jochen |
Vorteile superharter Nanocomposite Beschichtungen für Zerspanwerkzeuge, abgeschieden mittels High Power Pulse Magnetron Sputtering In: Jahrbuch Oberflächentechnik, 64, 81-88, 2008 | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Bolz, Stephan Frédéric |
Hydrano - Leistungssteigerung hydraulischer Verdrängereinheiten durch Nanocomposites In: WING, 2008, 2008 | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico |
Flux-free brazing of Mg-containing aluminium alloys by means of cold spraying In: Frontiers of mechanical engineering in China, 3 (4), 355-359, 2008 [DOI: 10.1007/s11465-008-0055-9] | Bobzin, Kirsten Zhao, Lidong Ernst, Felix Björn Gustav Richardt, Katharina Rebecca Maria |
Die Oberfläche macht den Unterschied : der systemische Lösungsansatz in der industriellen Plasma-Oberflächentechnik In: Intelligenter produzieren, 2008 (4), 10-12, 2008 | Bobzin, Kirsten Bagcivan, Nazlim |
Development of oxide dispersion strengthened MCrAlY coatings In: Journal of thermal spray technology : JTST, 17 (5/6), 853-857, 2008 [DOI: 10.1007/s11666-008-9244-7] | Bobzin, Kirsten Schläfer, Thomas Richardt, Katharina Rebecca Maria Brühl, Markus |
Verschleißschutz durch thermisches Spritzen : Stand und Perspektiven In: Stahl, 2008 (3), 28-30, 2008 | Bobzin, Kirsten Schläfer, Thomas Richardt, Katharina Rebecca Maria Kutschmann, Pia |
Tailor-made coatings for turbine applications using the Triplex Pro 200 In: Journal of thermal spray technology : JTST, 17 (5/6), 612-616, 2008 [DOI: 10.1007/s11666-008-9236-7] | Richardt, Katharina Rebecca Maria Bobzin, Kirsten Sporer, Dieter Schläfer, Thomas Fiala, Petr |
Mechanical properties and oxidation behaviour of (Al,Cr)N and (Al,Cr,Si)N coatings for cutting tools deposited by HPPMS In: Thin solid films, 517 (3), 1251-1256, 2008 [DOI: 10.1016/j.tsf.2008.06.050] | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp Bolz, Stephan Frédéric Cremer, Rainer Leyendecker, Thorsten |
An extremely successful ITSC 2008 In: Thermal spray bulletin, 1 (2), 90-92, 2008 | Bobzin, Kirsten Schläfer, Thomas Richardt, Katharina Rebecca Maria Brühl, Markus |
Titankarbidverstärkte Eisenbasiswerkstoffe : eine kostengünstige Lösung für Verschleißschutzanwendungen In: Thermal spray bulletin, 1 (2), 120-126, 2008 | Bobzin, Kirsten Schläfer, Thomas Richardt, Katharina Rebecca Maria Warda, Thomas Reisel, Guido |
Deposition of oxides as tool protection for large thixoforming dies by using the pulsed MSIP-PVD process In: Diffusion and defect data - solid state data : Pt. B. Solid state phenomena, 141/143, 249-254, 2008 [DOI: 10.4028/3-908451-59-0.249] | Bobzin, Kirsten Bagcivan, Nazlim Immich, Philipp |
Der Exzellenzcluster Integrative Produktionstechnik für Hochlohnländer der RWTH Aachen University : Herstellung hybrider Metall-Kunststoffbauteile durch moderne Fügeverfahren In: Joining plastics = Fügen von Kunststoffen, 2 (3), 210-216, 2008 | Bobzin, Kirsten Theiß, Sebastian Poprawe, Reinhart Rösner, Andreas Haberstroh, Edmund Flock, Dustin Reisgen, Uwe Wagner, Nikolaus |
Thermisches Spritzen : Potentiale, Entwicklungen, Märkte In: Thermal spray bulletin, 1 (1), 30-36, 2008 | Wielage, Bernhard Rupprecht, Christian Brühl, Markus Richardt, Katharina Rebecca Maria Ernst, Felix Björn Gustav Bobzin, Kirsten |
Auftraggelötete Verschleißschutzsysteme für Titanlegierungen In: Schweissen und Schneiden, 60 (10), 566-570, 2008 | Kopp, Nils Schlegel, Arne Ernst, Felix Björn Gustav Bobzin, Kirsten |
Microstructure based model for permeability predictions of open-cell metallic foams via homogenization In: Materials science & engineering / A, Structural materials: properties, microstructure and processing, 472 (1/2), 214-226, 2008 [DOI: 10.1016/j.msea.2007.03.046] | Laschet, Gottfried Kashko, Tatyana Angel, Stefanie Scheele, Josef Nickel, Reimo Bobzin, Kirsten Bleck, Wolfgang |
High-temperature brazing for reliable tungsten-CFC joints In: Physica scripta, T128, 175-181, 2007 [DOI: 10.1088/0031-8949/2007/T128/034] | Koppitz, Th. Pintsuk, G. Reisgen, Uwe Remmel, Josef Hirai, T. Sievering, R. Rojas Yoris, Yelena Casalegno, V. |
Hydroxylapatite coatings by microplasma spraying In: Wuji-cailiao-xuebao : jikan = Journal of inorganic materials, 22 (4), 754-758, 2007 [DOI: 10.3724/SP.J.1077.2007.00754] | He, Ding-Yong Sun, Xu-Feng Zhao, Lidong |
Wear behavior of Cr1-xAlxNPVD-coatings in dry running conditions In: Wear, 263 (7/12), 1274-1280, 2007 [DOI: 10.1016/j.wear.2007.01.118] | Bobzin, Kirsten Lugscheider, Erich Nickel, R. Bagcivan, Nazlim Krämer, A. |
Microstructure dependency of the material properties: Simulation approaches and calculation methods for non-homogeneous materials In: Steel research international, 78 (10/11), 804-811, 2007 | Bobzin, Kirsten Nickel, Reimo Parkot, Daniel Kashko, Tatyana |
C-Schichten In: WING, 2006, 2007 | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico Yilmaz, Koray |
Beschichtungsanlage für neue Werkstoffkombinationen : IOT mit Beschichtungsanlage der neuesten Generation In: Werkstoffe in der Fertigung : die Fachzeitschrift für technische Führungskräfte, 2007 (6), 2007 | Bobzin, Kirsten |
Beschichtungsanlage für neue Werkstoffkombinationen : IOT mit Beschichtungsanlage der neuesten Generation In: Aluminium : international journal for industry, research and application, 83, 81-81, 2007 | Bobzin, Kirsten |
Fügen mittels Kaltgasspritzen In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 98 (11), 2804-2805, 2007 | Bobzin, Kirsten |
Beschichtungsanlage für neue Werkstoffkombinationen : IOT mit Beschichtungsanlage der neuesten Generation In: Journal für Oberflächentechnik : JOT, 6 (12), 2007 | Bobzin, Kirsten |
Entwicklung und Charakterisierung einer Nanocomposite nc-ZrC/a-C:H Beschichtung für den Einsatz in hydraulischen Verdrängereinheiten In: Tribologie und Schmierungstechnik, 54 (4), 5-11, 2007 | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Göbbels, Nico |
Verschleißschutz für Titanbauteile In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 38 (2), 160-163, 2007 [DOI: 10.1002/mawe.200600106] | Bobzin, Kirsten Ernst, Felix Björn Gustav Rösing, Jürgen Rojas Yoris, Yelena |
Hochtemperaturlöten als Reparaturverfahren zur Erweiterung der Lebensdauer einkristalliner Turbinenkomponenten In: Schweissen und Schneiden, 59 (5), 249-252, 2007 | Bobzin, Kirsten Ernst, Felix Björn Gustav Rösing, Jürgen Schlegel, Arne Rojas Yoris, Yelena |
Auftraglöten zum Verschleißschutz von Titanwerkstoffen In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 38 (7), 533-537, 2007 [DOI: 10.1002/mawe.200700164] | Bobzin, Kirsten Ernst, F. Rösing, J. Rojas, Y. |
Kaltgasspritzen von Al-basierten Lotwerkstoffen zum Löten von Aluminium und Aluminiumlegierungen In: Info-Service / Fachgesellschaft Löten, 16, 16-18, 2007 | Bobzin, Kirsten Zhao, Lidong Kutschmann, Pia |
Investigation of particle flattening behaviour and bonding mechanisms of APS sprayed coatings on magnesium alloys In: Surface & coatings technology, 201 (14), 6290-6296, 2007 [DOI: 10.1016/j.surfcoat.2006.11.034] | Bobzin, Kirsten Lugscheider, Erich Zwick, Jochen Bernt Zhao, Lidong Parco, Maria |
Ökonomische und umweltverträgliche Umformtechnologien durch hochspezialisierte, funktionelle PVD-Werkzeugbeschichtungen In: Jahrbuch Oberflächentechnik, 63, 64-70, 2007 | Bobzin, Kirsten Nickel, Reimo Immich, Philipp Pinero, Carmen Warnke, Carsten |
PVD-Coatings in injection molding machines for processing optical polymers In: Plasma processes and polymers, 4 (Suppl. 1), S144-S149, 2007 [DOI: 10.1002/ppap.200730507] | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Manz, Florian |
Determination of multi parametical transversely isotropic coating properties based on simulation of nanoindentation In: International journal of surface science and engineering, 1 (2/3), 293-307, 2007 [DOI: 10.1504/IJSURFSE.2007.015030] | Bobzin, Kirsten Nickel, Reimo Parkot, Daniel Hurevich, Vitalii Göbbels, Nico |
Application of thermal barrier coatings on open porous metallics foams In: Plasma processes and polymers, 4.2007 (Suppl.1), S547-S550, 2007 [DOI: 10.1002/ppap.200731403] | Bobzin, Kirsten Lugscheider, Erich Nickel, Reimo Bagcivan, Nazlim |
Pulsed nanocomposite TiAlN coatings on complex shaped tools for high performance cutting operations In: Plasma processes and polymers, 4.2007 (Suppl.1), S673-S676, 2007 [DOI: 10.1002/ppap.200731703] | Bobzin, Kirsten Lugscheider, Erich Nickel, Reimo Immich, Philipp Bolz, Stephan Frédéric Klocke, Fritz |
Analyse von Partikeleigenschaften beim Thermischen Spritzen von Mikropulvern In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 38 (2), 149-154, 2007 [DOI: 10.1002/mawe.200600109] | Bobzin, Kirsten Lugscheider, Erich Ernst, Felix Björn Gustav Zwick, Jochen Bernt Matthäus, Götz |
Modeling and simulation in the production process control and material property calculation of complex structured EB-PVD TBCs In: Computational materials science, 39 (3), 600-610, 2007 [DOI: 10.1016/j.commatsci.2006.08.011] | Bobzin, Kirsten Lugscheider, Erich Nickel, Reimo |
Beschichtung von Zylinderlaufflächen moderner PKW-Motoren mit niedriglegierten Stählen und einem nanokristallinen Kompositwerkstoff In: Tribologie und Schmierungstechnik, 54 (2), 11-16, 2007 | Bobzin, Kirsten Lugscheider, Erich Ernst, Felix Björn Gustav Zwick, Jochen Bernt Schläfer, Thomas |
Study on cold spraying of Al-based brazing alloys In: Journal of thermal spray technology : JTST, 13 (2), 29-36, 2007 | Zhao, Lidong Zwick, Jochen Bernt Ernst, Felix Björn Gustav Bobzin, Kirsten Lugscheider, Erich |
Numerical studies of the application of shock tube technology for cold gas dynamic spray process In: Journal of thermal spray technology : JTST, 16 (5/6), 729-735, 2007 [DOI: 10.1007/s11666-007-9123-7] | Nickel, Reimo Bobzin, Kirsten Lugscheider, Erich Parkot, Daniel Varava, Waldemar Olivier, Herbert Luo, Xisheng |
Open porous metallic foams with thermal barrier coating and cooling hole array for high temperature turbine applications In: High temperature material processes, 11 (3), 321-343, 2007 [DOI: 10.1615/HighTempMatProc.v11.i3.20] | Angel, Stefanie Ratte, Evelin Bleck, Wolfgang Bobzin, Kirsten Lugscheider, Erich Nickel, R. Richardt, Katharina Rebecca Maria Bagcivan, Nazlim Walther, K. Kreutz, E. W. Kelbassa, Ingomar Poprawe, Reinhart |
PVD-Beschichtungen für trockenlaufende Hybridwälzlager In: Vakuum in Forschung und Praxis : VIP, 19 (2), 6-12, 2007 [DOI: 10.1002/vipr.200700313] | Gold, Peter Werner Loos, Jörg Plogmann, Michael Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Krämer, Anika |
Grain size evaluation of pulsed TiAlN nanocomposite coatings for cutting tools In: Thin Solid Films, 515 (3), 3681-3684, 2006 [DOI: 10.1016/j.tsf.2006.11.002] | Bobzin, Kirsten Lugscheider, E. Maes, M. Immich, P. Bolz, S. (Corresponding author) |
Wirtschaftliche Kaltmassivumformung - Neue Werkzeugbeschichtungen machen Verzicht auf Bonderbehandlung möglich In: Industrie-Anzeiger, 34/35, 43-43, 2006 | Bobzin, Kirsten Klocke, Fritz Zeppenfeld, Christoph Maßmann, Thomas Christoph Maes, Michael Pinero, Carmen Raedt, Hans-Willi |
Investigation of HVOF spraying on magnesium alloys In: Surface and coatings technology, 201 (6), 3269-3274, 2006 [DOI: 10.1016/j.surfcoat.2006.06.047] | Parco, Maria (Corresponding author) Zhao, Lidong Zwick, Jochen Bernt Bobzin, Kirsten Lugscheider, Erich |
Improvement of thermally sprayed abradable coating by microstructure control In: Surface & coatings technology, 201 (6), 2303-2312, 2006 [DOI: 10.1016/j.surfcoat.2006.03.047] | Faraoun, H. I. Grosdidier, T. Seichepine, J.-L. Goran, D. Aourag, H. Coddet, C. Zwick, Jochen Bernt Hopkins, Noel |
Alternative methods for determination of composition and porosity in abradable materials In: Materials characterization, 57 (1), 17-29, 2006 [DOI: 10.1016/j.matchar.2005.12.004] | Matejicek, Jiri Kolman, Blahoslav Dubsky, Jiri Neufuss, Karel Hopkins, Noel Zwick, Jochen Bernt |
Modelling route for abradable coatings In: Surface & coatings technology, 200 (22/23), 6578-6582, 2006 [DOI: 10.1016/j.surfcoat.2005.11.105] | Faraoun, H. I. Seichepine, J. L. Coddet, C. Aourag, H. Zwick, Jochen Bernt Hopkins, Noel Sporer, Dieter Hertter, M. |
High kinetic process developments in thermal spray technology In: Journal of thermal spray technology : JTST, 15 (2), 155-156, 2006 [DOI: 10.1361/105996306X108246] | Lugscheider, Erich |
Thermal spraying developments In: Advanced engineering materials, 8 (7), 595-596, 2006 | Berndt, C. Bobzin, Kirsten Coddet, C. Fauchais, P. Lugscheider, Erich Möhwald, K. Singheiser, L. Vardelle, A. |
C-Schichten In: WING : das Jahrbuch ; Projekte, Events und Ergebnisse / Projektträger Jülich, Forschungszentrum Jülich GmbH, 2006 | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Yilmaz, Koray |
HyDraNo - Leistungsteigerung in hydraulischen Verdrängereinheiten durch Nanocomposites In: WING : das Jahrbuch, 2006, 97-97, 2006 | Bobzin, Kirsten Nickel, Reimo Bagcivan, Nazlim Göbbels, Nico |
NaCoLab : Nanokristalline Composit-Beschichtungen für Zylinderlaufbahnen mit nanostrukturierter Oberfläche und Verschleißvorhersage für hochbelastete Benzin- und Dieselmotoren In: WING : das Jahrbuch, 2006, 29-29, 2006 | Bobzin, Kirsten Ernst, Felix Björn Gustav Zwick, Jochen Bernt Schläfer, Thomas |
Qualitätssicherung durch online Prozessdiagnostik In: Metalloberfläche : mo, 60 (11), 44-48, 2006 | Bobzin, Kirsten Ernst, Felix Björn Gustav Richardt, Katharina Rebecca Maria Zwick, Jochen Bernt Landes, Klaus Forster, G. Zierhut, Jochen |
Aufwendige Vorbehandlung erübrigt sich : Werkzeugbeschichtungen: Kaltmassivumformen wird Effizienter In: Industrie-Anzeiger, 128 (35), 43-43, 2006 | Klocke, Fritz Zeppenfeld, Christoph Maßmann, Thomas Christoph Bobzin, Kirsten Maes, Michael Pinero, Carmen Raedt, Hans-Willi Filgertshofer, Robert |
Werkzeugbeschichtung: Verlagerung bringt Vorteile In: Werkzeug & Formenbau, 16 (4), 27-27, 2006 | Klocke, Fritz Zeppenfeld, Christoph Maßmann, Thomas Christoph Bobzin, Kirsten Maes, Michael Pinero, Carman Raedt, Hans-Willi Filgertshofer, Robert |
Umwelt schonende und wirtschaftliche Kaltmassivumformung In: Der Schnitt- & Stanzwerkzeugbau, 10 (4), 59-60, 2006 | Bobzin, Kirsten Maes, Michael Pinero, Carmen Klocke, Fritz Zeppenfeld, Christoph Maßmann, Thomas Christoph Raedt, Hans-Willi Filgertshofer, Robert |
Statt der Teile die Werkzeuge beschichten : Kaltmassivumformung: Auf Bondern gänzlich verzichten In: Produktion : Technik und Wirtschaft für die deutsche Industrie, 45 (18), 10-10, 2006 | Klocke, Fritz Zeppenfeld, Christoph Maßmann, Thomas Christoph Bobzin, Kirsten Maes, Michael Pinero, Carmen Raedt, Hans-Willi Filgertshofer, Robert |
Umwelt schonende und wirtschaftliche Kaltmassivumformung In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 97 (6), 1526-1527, 2006 | Bobzin, Kirsten Maes, Michael Pinero, Carmen Klocke, Fritz Zeppenfeld, Christoph Maßmann, Thomas Christoph Raedt, Hans-Willi Filgertshofer, Robert |
The Influence of Substrate Preparation on the PVD Coating Graded Zirconium Carbide (ZrCg) and Chromium Aluminium Nitride (CrAlN) In: Thin solid films, 2006, 2006 | Bobzin, Kirsten Bagcivan, Nazlim Göbbels, Nico Manz, Florian |
Deposition of HA coatings by microplasma spraying In: Das Dental-Labor, 7 (1), 126-126, 2006 [DOI: 10.1515/BIOMAT.2006.7.1.7] | Bobzin, Kirsten Zwick, Jochen Bernt Zhao, Lidong |
Umweltverträgliche Kaltmassivumformung - PVD-Beschichtung statt bondern In: Journal für Oberflächentechnik : JOT, 2006 (1), 30-31, 2006 | Bobzin, Kirsten Lugscheider, Erich Nickel, Reimo Immich, Philipp Pinero, Carmen Warnke, Carsten Klocke, F. Maßmann, Th. Liauw, M. Eichholz, S. Raedt, H.-W. Filgertshofer, R. |
Investigation on the Thermal Behavior of Graded and Multilayered Lanthanum Zirconate as EB-PVD Thermal Barrier Coating In: Journal of vacuum science & technology / A, Vacuum, surfaces, & films, 24 (4), 2006 | Bobzin, Kirsten Lugscheider, Erich Bagcivan, Nazlim |
Funktionelle Oberflächenbeschichtungen durch Plasmaspritzen In: PlasmaNews, 2006 (1), 2006 | Bobzin, Kirsten Lugscheider, Erich Zwick, Jochen Bernt |
Eigenspannungsreduzierende Maßnahmen für flächige Lötverbindungen in der Mikrosytemtechnik In: Schweissen und Schneiden, 58 (5), 238-246, 2006 | Bach, Friedrich-Wilhelm Holländer, Ulrich Bobzin, Kirsten Varava, Waldemar Möhwald, Kai Roxlau, Christian Nickel, Reimo |
Völlig abgelöst - PVD-Schichtsystem verhindert anhaftende Schmelze an Spritzgiessmaschinen In: Der Plastverarbeiter : PV, 57 (8), 42-42, 2006 | Bobzin, Kirsten Bagcivan, Nazlim Manz, Florian |
PVD-Beschichtungen auf Plastifizierschnecken In: Kunststoffe / [Deutsche Ausgabe], 96 (8), 66-68, 2006 | Michaeli, Walter Bobzin, Kirsten Heßner, Sebastian Neuß, Andreas Manz, Florian |
CrAlN-PVD-Niedertemperaturbeschichtung zum Verschleißschutz von Bauteilen In: Tribologie und Schmierungstechnik, 53 (1), 2889-2898, 2006 | Bobzin, Kirsten Lugscheider, Erich Maes, Michael |
Einsatz von PVD/CVD-Schichten bei Wälzlagern In: Jahrbuch Oberflächentechnik, 62, 106-124, 2006 | Bobzin, Kirsten Maes, Michael |
Production and characterization of NiAl-Ta-Cr intermetallic coatings sprayed by high velocity oxy-fuel In: Xiyou-jinshu-cailiao-yu-gongcheng = Rare metal materials and engineering, 35 (6), 974-977, 2006 | Zhao, Lidong He, Dingyong Bobzin, Kirsten Lugscheider, Erich |
Application of multiscale modeling in the coating formation simulation of APS PYSZ TBCs In: Journal of thermal spray technology : JTST, 15 (4), 537-544, 2006 [DOI: 10.1361/105996306X147063] | Lugscheider, Erich Bobzin, Kirsten Nickel, Reimo |
Study on the influence of plasma spray processes and spray parameters on the structure and crystallinity of hydroxylapatite coatings In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 37 (6), 516-520, 2006 [DOI: 10.1002/mawe.200600029] | Zhao, Lidong Bobzin, Kirsten Ernst, Felix Björn Gustav Zwick, Jochen Bernt Lugscheider, Erich |
(Cr1-x,Alx)N ein Review über ein vielseitig einsetzbares Schichtsystem In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 37 (10), 833-841, 2006 [DOI: 10.1002/mawe.200600048] | Bobzin, Kirsten Lugscheider, Erich Nickel, R. Immich, Philipp |
Thermal cycling behavior of yttria stabilized zirconia and lanthanum zirconate, as graded and bilayer EB-PVD thermal barrier coatings In: High temperature material processes, 10 (1), 103-115, 2006 [DOI: 10.1615/HighTempMatProc.v10.i1.80] | Bobzin, Kirsten Lugscheider, Erich Bagcivan, Nazlim |
Alumina PVD tool coatings for the use in semi solid metal forming of steel In: Diffusion and defect data - solid state data : Pt. B. Solid state phenomena, 116/117, 704-707, 2006 [DOI: 10.4028/www.scientific.net/SSP.116-117.704] | Bobzin, Kirsten Lugscheider, Erich Maes, Michael Immich, Philipp |
Microstructure and properties of atmospheric plasma sprayed AP40 bioactive glass-ceramic coatings In: Wuji-cailiao-xuebao : jikan = Journal of inorganic materials, 21 (3), 759-763, 2006 [DOI: 10.3724/SP.J.1077.2006.00759] | He, Ding-Yong Zhao, Lidong Bobzin, Kirsten Lugscheider, Erich |
New soldering processes and solder systems for hybrid microsystems : developments and applications In: Microsystem technologies, 12 (7), 620-625, 2006 [DOI: 10.1007/s00542-006-0079-1] | Bobzin, Kirsten Lugscheider, Erich Zhuang, H. Ernst, Felix Björn Gustav Bagcivan, Nazlim Maes, Michael Rösing, J. Ferrara, Stefania Erdle, Anja Krämer, A. |
Atmospheric plasma spraying of thermal barrier coating material ZrO2-7%/Y2O3 using on-line particle monitoring In: Advanced engineering materials, 8 (4), 268-270, 2006 [DOI: 10.1002/adem.200500272] | Zhao, Lidong Bobzin, Kirsten Ernst, Felix Björn Gustav Lugscheider, Erich |
Feasibility study of brazing aluminium alloys through pre-deposition of a braze alloy by cold spray process In: Advanced engineering materials, 8 (8), 751-753, 2006 [DOI: 10.1002/adem.200600001] | Zhao, Lidong Bobzin, Kirsten Ernst, Felix Björn Gustav Zwick, Jochen Bernt Rösing, Jürgen Lugscheider, Erich |
Assessment of the microplasma spraying process for coating application In: Advanced engineering materials, 8 (7), 635-639, 2006 [DOI: 10.1002/adem.200600054] | Lugscheider, Erich Bobzin, Kirsten Zhao, Lidong Zwick, Jochen Bernt |
Deposition of aluminium alloy Al12Si by cold spraying In: Advanced engineering materials, 8 (4), 264-267, 2006 [DOI: 10.1002/adem.200500227] | Zhao, Lidong Bobzin, Kirsten He, Dingyong Zwick, Jochen Bernt Ernst, Felix Björn Gustav Lugscheider, Erich |
Carbon based tool coatings as an approach for environmentally friendly metal forming processes In: Wear, 260 (3), 287-295, 2006 [DOI: 10.1016/j.wear.2005.04.026] | Klocke, Fritz Maßmann, Thomas Christoph Bobzin, Kirsten Lugscheider, Erich Bagcivan, Nazlim |
Advanced homogenization strategies in material modeling of thermally sprayed TBCs In: Advanced engineering materials, 8 (7), 663-669, 2006 [DOI: 10.1002/adem.200600046] | Bobzin, Kirsten Lugscheider, Erich Nickel, Reimo Kashko, Tatyana |
Thermal cycling behaviour of lanthanum zirconate as EB-PVD thermal barrier coating In: Advanced engineering materials, 8 (7), 653-657, 2006 [DOI: 10.1002/adem.200600055] | Bobzin, Kirsten Lugscheider, Erich Bagcivan, Nazlim |
The influence of hot isostatic pressing on plasma sprayed coatings properties In: Surface & coatings technology, 201 (3/4), 1224-1227, 2006 [DOI: 10.1016/j.surfcoat.2006.01.046] | Abdel-Samad, Abdou Lugscheider, Erich Bobzin, Kirsten Maes, Michael |
Relation of hardness and oxygen flow of Al2O3 coatings deposited by reactive bipolar pulsed magnetron sputtering In: Thin solid films, 494 (1/2), 255-262, 2006 [DOI: 10.1016/j.tsf.2005.08.162] | Bobzin, Kirsten Lugscheider, Erich Maes, Michael Pinero, Carmen |
Integrated approach for the development of advanced, coated gas turbine blades In: Advanced engineering materials, 8 (6), 535-562, 2006 [DOI: 10.1002/adem.200500277] | Herzog, R. Warnken, Nils Steinbach, Ingo Hallstedt, Bengt Walter, C. Müller, Jochen Hajas, David E. Münstermann, Ernst Schneider, Jochen M. Nickel, Reimo Parkot, Daniel Bobzin, Kirsten Lugscheider, Erich Bednarz, P. Trunova, O. Singheiser, Lorenz |
A systematic approach to material eligibility for the cold-spray process In: Journal of thermal spray technology : JTST, 14 (1), 125-133, 2005 [DOI: 10.1361/10599630522738] | Vlcek, J. Gimeno, L. Huber, H. Lugscheider, Erich |
Metallographic investigations of composite structures of aluminium foam with thermally sprayed coatings In: Praktische Metallographie = Practical metallography, 42 (1), 5-14, 2005 | Maurer, Matthias Josef Koch, Dieter Zhao, Lidong Lugscheider, Erich |
Superelastic (Cr,Al)N coatings for high end spindle bearings In: Surface & coatings technology, 200.2006 (5/6), 1738-1744, 2005 [DOI: 10.1016/j.surfcoat.2005.08.043] | Brecher, Christian Spachtholz, Guido Bobzin, Kirsten Lugscheider, Erich Knotek, Otto Maes, Michael |
PVD-Beschichtungen schützen die Kontaktpartner In: Facts - CemCon, 2005 (24), 8-9, 2005 | Brecher, Christian Bobzin, Kirsten Maes, Michael Gold, Peter Werner Kuhn, Marius Bugiel, Christoph |
Hybridprozesstechnik zur Plasmasynthese temperaturbeständiger Kohlenstoffschichten In: WING : das Jahrbuch, 2005, 2005 | Bobzin, Kirsten Lugscheider, Erich Bagcivan, Nazlim |
Innovative PVD-Beschichtungen für das Thixoforming von Stahl In: Jahrbuch Oberflächentechnik, 61, 2005 | Bobzin, Kirsten Lugscheider, Erich Maes, Michael |
Plasmalöten von Aluminium- und Magnesiumlegierungen In: Der Praktiker, 97, 118-119, 2005 | Bobzin, Kirsten Lugscheider, Erich Ernst, Felix Björn Gustav Jäger, Doris Rösing, J. |
Aktuelle Entwicklungstrends in der thermischen Spritztechnik - eine Kurzübersicht In: Schweissen und Schneiden, 57 (4), 137-140, 2005 | Lugscheider, Erich Bobzin, Kirsten Zwick, J. |
Established protective tool coatings for difficult machining operations In: Journal of vacuum science & technology / A, Vacuum, surfaces, & films, 24.2006.4, 2005 | Bobzin, Kirsten Maes, Michael Pinero, Carmen |
Mikroplasmaspritzen ein Verfahren für kleine Bauteile In: Schweissen und Schneiden, 57 (10), 564-568, 2005 | Bobzin, Kirsten Lugscheider, Erich Zwick, J. Zhao, Lidong |
(C,Al)N Beschichtungen für Hoschgeschwindigkeitsspindellager, Proceedings: GfT- 46. Tribologiefachtagung 26.-28.09.05, Göttingen Vortrag 22, Band I In: Tribologie und Schmierungstechnik, 53 (3/06), 17-21, 2005 | Bobzin, Kirsten Lugscheider, Erich Maes, Michael |
Investigation of the stability of tetragonal PVD zirconia coatings without dopants In: International journal of adhesion & adhesives, 27.2007 (5 : Special issue), 2005 | Lugscheider, Erich Bobzin, Kirsten Maes, Michael Immich, Philipp |
Method of resolution to inhibit the growth of alumina in the intermetallic NiAl FG 75 alloy to increase TBC lifetime In: Surface & coatings technology, 200.2005 (5/6), 2005 | Bobzin, Kirsten Lugscheider, Erich Maes, Michael Lackner, Kristijan |
Einfluss von Silizium-Dotierungen auf das Reibverhalten von kohlenstoffbasierten PVD-Beschichtungen In: Tribologie und Schmierungstechnik, 52 (6), 37-41, 2005 | Lugscheider, Erich Bobzin, Kirsten Bagcivan, Nazlim |
Laser drilled microholes in zirconia coated surfaces using two variants to implement the effusion cooling of first stage turbine blades In: Advanced engineering materials, 7 (3), 145-152, 2005 [DOI: 10.1002/adem.200400148] | Lugscheider, Erich Bobzin, Kirsten Maes, Michael Lackner, K. Poprawe, Reinhart Kreutz, E. W. Willach, J. |
The effect of pulse sequence modulation and pulse energy on structural coating properties and coating composition In: Surface & coatings technology, 200 (5/6), 1560-1565, 2005 [DOI: 10.1016/j.surfcoat.2005.08.064] | Bobzin, Kirsten Lugscheider, Erich Maes, Michael |
Monte Carlo simulation of the PVD transport process for alloys In: Surface & coatings technology, 200.2005 (1/4), 913-915, 2005 [DOI: 10.1016/j.surfcoat.2005.02.141] | Lugscheider, Erich Bobzin, Kirsten Papenfuß-Janzen, Nobert Parkot, Daniel |
Advancement in low melting solder deposition by pulsed magnetron sputter-PVD process for microsystemtechnology In: Surface & coatings technology, 200.2005 (1/4), 444-447, 2005 [DOI: 10.1016/j.surfcoat.2005.02.193] | Lugscheider, Erich Bobzin, Kirsten Maes, Michael Ferrara, Stefania Erdle, Anja |
HVOF spraying of Al 2O 3-dispersion-strengthened NiCr powders In: Surface & coatings technology, 182 (1), 72-77, 2004 [DOI: 10.1016/S0257-8972(03)00874-0] | Zhao, Lidong Zwick, Jochen Bernt Lugscheider, Erich |
High velocity oxy-fuel thermal spraying of a NiCoCrAlY alloy In: Surface & coatings technology, 179 (2/3), 272-278, 2004 [DOI: 10.1016/S0257-8972(03)00818-1] | Zhao, Lidong Parco, Maria Lugscheider, Erich |
Characterisation and optimisation of innovative solders for transient liquid phase bonding and active soldering In: Advanced engineering materials, 6 (3), 160-163, 2004 [DOI: 10.1002/adem.200300538] | Lugscheider, Erich Ferrara, S. |
Progress and developments in the field of materials for transient liquid phase bonding and active soldering processes In: Microsystem technologies, 10 (3), 233-236, 2004 [DOI: 10.1007/s00542-003-0351-6] | Lugscheider, Erich Ferrara, S. Janssen, H. Reimann, A. Wildpanner, B. |
Plasma diagnostics as a tool for the modeling and simulation of sputter processes In: Surface & coatings technology, 177-178, 597-602, 2004 [DOI: 10.1016/j.surfcoat.2003.08.066] | Lugscheider, Erich Papenfuss-Janzen, Norbert |
The new easyFoam-process and mechanical properties of foam-coating-sandwiches In: Advanced materials, 6 (11), 893-896, 2004 [DOI: 10.1002/adem.200300523] | Maurer, M. Zhao, Lidong Lugscheider, Erich |
Neue PVD-Schichtkonzepte für hoch beanspruchte Werkzeuge für umweltverträgliche Fertigungsprozesse In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 35 (10/11), 851-857, 2004 [DOI: 10.1002/mawe.200400804] | Bobzin, Kirsten Lugscheider, Erich Piñero, C. |
Influence of spray parameters on the particle in-flight properties and the properties of HVOF coating of WC-CoCr In: Wear, 257 (1/2), 41-46, 2004 [DOI: 10.1016/j.wear.2003.07.002] | Zhao, Lidong Maurer, Matthias Josef Fischer, Falko Dicks, Robert Lugscheider, Erich |
Study of HVOF spraying of WC-CoCr using on-line particle monitoring In: Surface & coatings technology, 185 (2/3), 160-165, 2004 [DOI: 10.1016/j.surfcoat.2003.12.024] | Zhao, Lidong Maurer, Matthias Josef Fischer, Falko Lugscheider, Erich |
Wear behaviour of Al2O3 dispersion strengthened MCrAlY coating In: Surface & coatings technology, 184 (2/3), 298-306, 2004 [DOI: 10.1016/j.surfcoat.2003.10.055] | Zhao, Lidong Parco, Maria Lugscheider, Erich |
Development of a superlattice (Ti,Hf,Cr)N coating for cold metal forming applications In: Surface & coatings technology, 177/178.2004, 616-622, 2004 [DOI: 10.1016/S0257-8972(03)00935-6] | Lugscheider, Erich Bobzin, Kirsten Pinero, Carmen Klocke, Fritz Maßmann, Thomas Christoph |
Lanthanzirkonat : ein innovatives Wärmedämmschichtmaterial In: Vakuum in Forschung und Praxis : VIP, 16, 170-175, 2004 [DOI: 10.1002/vipr.200400229] | Lugscheider, Erich Bobzin, Kirsten Lackner, Kristijan |
Modernste PVD-Dünnschichttechnologie erobert neue Märkte In: Jahrbuch Oberflächentechnik, 60, 108-125, 2004 | Lugscheider, Erich Bobzin, Kirsten Maes, Michael |
Herstellung eines Mikroaktors auf der Basis lasergestützter Strukturierung von PVD-abgeschiedenen Bimetallstrukturen In: Produktion von Leiterplatten und Systemen : PLUS, 6 (5), 2004 | Lugscheider, Erich Bobzin, Kirsten Erdle, Anja Horn, A. Pütz, U. Kreutz, E. W. Poprawa, R. |
High-performance chromium aluminium nitride PVD coatings on roller bearings In: Surface & coatings technology, 188/189.2004, 649-654, 2004 [DOI: 10.1016/j.surfcoat.2004.07.030] | Bobzin, Kirsten Lugscheider, Erich Maes, Michael Gold, Peter Werner Loos, J. Kuhn, M. |
PVD-Niedertemperaturbeschichtung für Bauteile zur Integration tribologischer Funktionen in die Oberfläche In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 35 (10/11), 843-850, 2004 [DOI: 10.1002/mawe.200400803] | Bobzin, Kirsten Lugscheider, Erich Maes, Michael |
Plasma diagnostical comparison of the MSIP process of (Ti,Al)N with pulsed and dc power supplies using energy-resolved mass spectroscopy In: Surface & coatings technology, 188/189, 164-167, 2004 [DOI: 10.1016/j.surfcoat.2004.08.011] | Lugscheider, Erich Bobzin, Kirsten Papenfuß-Janzen, Norbert Maes, Michael Parkot, Daniel |
Active soft solder deposition by magnetron-sputter-ion-plating (MSIP)-PVD-process In: Thin solid films, 447/448.2004, 327-331, 2004 [DOI: 10.1016/S0040-6090(03)01110-6] | Lugscheider, Erich Bobzin, Kirsten Erdle, Anja |
On the coating of polymers : basic investigations In: Thin solid films, 459.2004 (1/2), 313-317, 2004 [DOI: 10.1016/j.tsf.2003.12.134] | Lugscheider, Erich Bobzin, Kirsten Maes, Michael Krämer, Anika |
Characterization of steel thixoforming tool materials by high temperature compression tests In: Steel research international, 75.2004 (8/9), 569-576, 2004 | Kopp, Reiner Shimahara, Hideki Schneider, Jochen M. Kurapov, Denis Telle, Rainer Münstermann, Simon Lugscheider, Erich Abdel-Samad, Abdou Bobzin, Kirsten Maes, Michael |
Thermal spraying of a nitrogen alloyed austenitic steel In: Thin solid films, 424 (2), 213-218, 2003 [DOI: 10.1016/S0040-6090(02)01047-7] | Zhao, Lidong Maurer, Matthias Josef Lugscheider, Erich |
Finite element simulation of a coating formation on a turbine blade during plasma spraying In: Surface & coatings technology, 174-175, 475-481, 2003 [DOI: 10.1016/S0257-8972(03)00331-1] | Lugscheider, Erich Nickel, R. |
First results on duplex coatings without intermediate mechanical treatment In: Surface & coatings technology, 174-175, 671-676, 2003 [DOI: 10.1016/S0257-8972(03)00578-4] | Kamminga, J. D. Hoy, R. Janssen, G. C. A. Lugscheider, Erich Maes, M. |
Investigation of thermal spraying processes using simulation methods In: Journal of materials processing technology, 26 (2), 217-226, 1991 [DOI: 10.1016/0924-0136(91)90135-2] | Elsing, Rainer Knotek, Otto Balting, U. |
Oberflächen tunen - PVD/CVD-Dünnschichttechnologie In: Metalloberfläche : mo, 57 (9), 33-37, 2003 | Lugscheider, Erich Bobzin, Kirsten Maes, Michael |
Erosion- und brandrissmindernde PVD-Hartstoffschichten für Aluminium und Magnesium-Druckgießformen In: International foundry research, 55 (3), 93-97, 2003 | Lugscheider, Erich Bobzin, Kirsten Maes, Michael |
New concepts of graded zirconium carbide coatings for components In: Surface & coatings technology, 177/178.2004, 2003 | Lugscheider, Erich Knotek, Otto Bobzin, Kirsten Maes, Michael |
Low temperature deposition of CrAlN coatings for the application on machine parts In: Surface & coatings technology, 177/178.2004, 2003 | Lugscheider, Erich Bobzin, Kirsten Maes, Michael |
Increasing AlN amount in magnetron sputtered Cr(1-x)Al(x)N PVD-coatings for high temperature applications by means of pulsed power supplies In: Surface & coatings technology, 177/178.2004, 2003 | Lugscheider, Erich Bobzin, Kirsten Maes, Michael |
Study on atmospheric plasma spraying of Al2O3 using on-line particle monitoring In: Surface & coatings technology, 136/138 (2/3), 258-262, 2003 [DOI: 10.1016/S0257-8972(03)00201-9] | Lugscheider, Erich Zhao, Lidong Seemann, Klaus Fischer, Arne |
Influence of the spraying processes on the properties of 316L stainless steel coatings In: Surface & coatings technology, 162 (1), 6-10, 2003 [DOI: 10.1016/S0257-8972(02)00560-1] | Lugscheider, Erich Zhao, Lidong |
The influence of milling parameters on the properties of the milled powders and the resultant coatings In: Surface & coatings technology, 168 (2/3), 179-185, 2003 [DOI: 10.1016/S0257-8972(03)00202-0] | Lugscheider, Erich Zwick, Jochen Bernt Zhao, Lidong |
Investigations of mechanical and tribological properties of CrAlN+C thin coatings deposited on cutting tools In: Surface & coatings technology, 174/175.2003, 681-686, 2003 [DOI: 10.1016/S0257-8972(03)00566-8] | Lugscheider, Erich Bobzin, Kirsten Lackner, Kristijan |
Determination of mechanical properties of electron beam-physical vapor deposition-thermal barrier coatings (EB-PVD-TBCs) by means of nanoindentation and impact testing In: Surface & coatings technology, 163/164, 75-80, 2003 [DOI: 10.1016/S0257-8972(02)00594-7] | Bouzakis, K.-D. Lontos, A. Michailidis, N. Knotek, Otto Lugscheider, Erich Bobzin, Kirsten Etzkorn, Achim Helmut |
Solder deposition for transient liquid phase (TLP)-bonding by MSIP-PVD-process In: Surface & coatings technology, 174/175.2003, 704-707, 2003 [DOI: 10.1016/S0257-8972(03)00692-3] | Lugscheider, Erich Bobzin, Kirsten Erdle, Anja |
Wettability of PVD compound materials by lubricant In: Surface & coatings technology, 165 (1), 51-57, 2003 [DOI: 10.1016/S0257-8972(02)00724-7] | Lugscheider, Erich Bobzin, Kirsten |
In-flight reactions of metallic particles during thermal spraying In: Advanced engineering materials, 4 (12), 922-924, 2002 [DOI: 10.1002/adem.200290005] | Zhao, Lidong Herbst-Dederichs, C. Lugscheider, Erich |
Surface refinement of metal foams In: Advanced engineering materials, 4 (10), 791-797, 2002 [DOI: 10.1002/1527-2648(20021014)4:10<791::AID-ADEM791>3.0.CO;2-Q] | Maurer, Matthias Josef Zhao, Lidong Lugscheider, Erich |
High-temperature brazing of superalloys and stainless steels with novel ductile Ni-Hf-based filler metals In: Advanced engineering materials, 4 (3), 138-142, 2002 [DOI: 10.1002/1527-2648(200203)4:3<138::AID-ADEM138>3.0.CO;2-Y] | Lugscheider, Erich Humm, S. |
High velocity oxy-fuel spraying of a NiCoCrAlY and an intermetallic NiAl-TaCr alloy In: Surface & coatings technology, 149 (2/3), 230-235, 2002 [DOI: 10.1016/S0257-8972(01)01444-X] | Zhao, Lidong Lugscheider, Erich |
Process and advantage of multicomponent and multilayer PVD coatings In: Surface & coatings technology, 59 (1/3), 14-20, 1993 [DOI: 10.1016/0257-8972(93)90048-S] | Knotek, O. Löffler, Frank Krämer, G. |
Ceramic cathodes for arc-physical vapour deposition : development and application In: Surface & coatings technology, 49 (1/3), 263-267, 1991 [DOI: 10.1016/0257-8972(91)90066-6] | Knotek, Otto Löffler, Frank Bohmer, M. Breidenbach, R. Stossel, C. |
Amorphous carbon physically vapour deposited coatings In: Surface & coatings technology, 49 (1/3), 370-373, 1991 [DOI: 10.1016/0257-8972(91)90085-B] | Knotek, Otto Löffler, Frank Brand, J. Burgmer, W. |
PVD-beschichtete Zerspanwerkzeuge für moderne Zerspanoperationen (Teil 1) In: Stahl, 2002 (3), 45-47, 2002 | Lugscheider, Erich Bobzin, Kirsten Hornig, Thomas Colmenares, C. |
PVD-beschichtete Zerspanwerkzeuge für moderne Zerspanoperationen (Teil 2) In: Stahl, 2002 (4), 45-47, 2002 | Lugscheider, Erich Bobzin, Kirsten Hornig, Thomas Colmenares, C. |
Übertragung tribologischer Funktionen der Schmierstoffe auf die Werkstoffoberfläche mittels PVD-Technologie In: Tribologie und Schmierungstechnik, 49 (1), 16-20, 2002 | Lugscheider, Erich Bobzin, Kirsten |
Wenn Schichten laufen wie geschmiert... : Moderne PVD-Schichten ersetzen umweltgefährdende Schmierstoff-Additive In: RWTH-Themen : Berichte aus der Rheinisch-Westfälischen Technischen Hochschule Aachen, 2002 (1), 81-83, 2002 | Beckers, Manfred Lugscheider, Erich Bobzin, Kirsten Hornig, Th. |
Das tribologische Verhalten von neu entwickelten PVD-Schichten für die umweltverträgliche Kaltumformung In: Tribologie und Schmierungstechnik, 49 (6), 19-25, 2002 | Lugscheider, Erich Bobzin, Kirsten Beckers, M. Colmenares, C. Klocke, F. Raedt, H.-W. |
Energy resolved ion mass spectroscopy of (Ti,Al)N hard coatings deposited by bipolar pulsed magnetron sputtering In: Surface & coatings technology, 174/175, 2002 | Lugscheider, Erich Bobzin, Kirsten Papenfuß-Janzen, Norbert Erkens, Georg Cremer, R. Rambadt, S. |
Reactive plasma spraying of TiAl6V4 alloy In: Wear, 253 (11/12), 1214-1218, 2002 [DOI: 10.1016/S0043-1648(02)00246-6] | Lugscheider, Erich Zhao, Lidong |
Berechnung von Wärmebehandlungsprozessen - Welche Möglichkeiten hat der Praktiker? Teil I: Temperaturfelder und verwandte Eigenschaften wie Gefüge und Härte In: Der Wärmebehandlungsmarkt : Daten, Fakten, Angebote / Dr. Sommer Werkstofftechnik GmbH, 2002 (3), 5-8, 2002 | Elsing, Rainer |
Graded EB-PVD-thermal barrier coatings produced by powder evaporation In: Advanced engineering materials, 4 (12), 919-922, 2002 [DOI: 10.1002/adem.200290004] | Lugscheider, Erich Bobzin, Kirsten Etzkorn, Achim Helmut Syrokas, G. Siry, C. W. |
Investigation of the residual stresses and mechanical properties of (Cr,Al)N arc PVD coatings used for semi-solid metal (SSM) forming dies In: Thin solid films, 420/421, 318-323, 2002 [DOI: 10.1016/S0040-6090(02)00831-3] | Lugscheider, Erich Bobzin, Kirsten Hornig, Thomas Maes, Michael |
Testing and design of tool coatings with properties adapted to the use of biodegradable cutting fluids In: CIRP annals : manufacturing technology, 50 (1), 57-60, 2001 [DOI: 10.1016/S0007-8506(07)62070-8] | Klocke, Fritz Krieg, T. Lugscheider, Erich Bobzin, Kirsten |
PVD-Beschichtungen lassen Kunststoffe kalt In: Metalloberfläche : mo, 55 (10), 34-37, 2001 | Lugscheider, Erich Bobzin, Kirsten Hornig, Thomas Beckers, M. |
Deposition of solder for micro-joining on M.E.M.S. components by means of magnetron sputtering In: Surface & coatings technology, 142/144, 813-816, 2001 [DOI: 10.1016/S0257-8972(01)01182-3] | Lugscheider, Erich Bobzin, Kirsten Lake, Michael K. |
Atomistic simulation of surface evolution during PVD coating processes In: Surface & coatings technology, 142/144, 923-927, 2001 [DOI: 10.1016/S0257-8972(01)01316-0] | Lugscheider, Erich Hayn, G. v. |
Thermal spraying of a high nitrogen duplex austenitic-ferritic steel In: Surface & coatings technology, 141 (2/3), 208-215, 2001 [DOI: 10.1016/S0257-8972(01)01233-6] | Lugscheider, Erich Zhao, Lidong Fischer, A. Reimann, A. |
Systematische Entwicklung gradierter ZrC und HfC Schichten für tribologische Anwendungen am Beispiel von hydraulischen Komponenten In: Tribologie und Schmierungstechnik, 48 (1), 2001 | Lugscheider, Erich Bobzin, Kirsten Burckhardt, M. Murrenhoff, Hubertus van Bebber, David |
Metall-Kohlenstoffschichten (ZrCg und HfCg) für den Einsatz in hydraulischen Komponenten In: O + P : Fluidtechnik für den Maschinen- und Anlagenbau, 45 (5), 361-, 2001 | Murrenhoff, Hubertus van Bebber, David Lugscheider, Erich Bobzin, Kirsten Burckhardt, M. |
Widening the usability of yttria stabilised zirconia by advanced cooling technology In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 32 (8), 660-664, 2001 [DOI: 10.1002/1521-4052(200108)32:8<660::AID-MAWE660>3.0.CO;2-G] | Lugscheider, Erich Bobzin, Kirsten Etzkorn, Achim Helmut |
Characteristic curves of voltage and current phase generation and properties of tungsten- and vanadium-oxides deposited by reactive d.c.-MSIP-PVD-process for self-lubricating applications In: Surface & coatings technology, 142/144, 137-142, 2001 [DOI: 10.1016/S0257-8972(01)01318-4] | Lugscheider, Erich Knotek, Otto Bärwulf, Stephan Bobzin, Kirsten |
The influence on surface free energy of PVD-coatings In: Surface & coatings technology, 142/144, 755-760, 2001 [DOI: 10.1016/S0257-8972(01)01315-9] | Lugscheider, Erich Bobzin, Kirsten |
Mechanical properties of EB-PVD-thermal barrier coatings by nanoindentation In: Surface & coatings technology, 138 (1), 9-13, 2001 [DOI: 10.1016/S0257-8972(00)01147-6] | Lugscheider, Erich Bobzin, Kirsten Bärwulf, Stephan Etzkorn, Achim Helmut |
A comparative study on thermally sprayed alumina based ceramic coatings In: Journal of materials science : JMS, 35 (12), 3127-3130, 2000 [DOI: 10.1023/A:1004824104162] | Abdel-Samad, A. A. El-Bahloul, A. M. Lugscheider, Erich Rassoul, S. A. |
Erhöhung und Charakterisierung der Festigkeit von Metallschäumen für lasttragende Anwendungen durch thermisch gespritzte Verbundstrukturen In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 31 (6), 523-526, 2000 [DOI: 10.1002/1521-4052(200006)31:6<523::AID-MAWE523>3.0.CO;2-%23] | Maurer, Matthias Josef Lugscheider, Erich |
Tribological behaviour at room temperature and at 550°C of TiC-based plasma sprayed coatings in fretting gross slip conditions In: Wear, 244 (1/2), 165-179, 2000 [DOI: 10.1016/S0043-1648(00)00455-5] | Economou, S. de Bonte, M. Celis, J. P. Smith, R. W. Lugscheider, Erich |
Electron beam-physical vapor deposition - thermal barrier coatings on laser drilled surfaces for transpiration cooling In: Surface & coatings technology, 133/134, 49-53, 2000 [DOI: 10.1016/S0257-8972(00)00872-0] | Lugscheider, Erich Bobzin, Kirsten Etzkorn, Achim Helmut Horn, Alexander Weichenhain, Ruth Kreutz, Ernst Wolfgang Poprawe, Reinhart |
Functional metal based coatings on ceramic substrates In: Surface & coatings technology, 132, 222-276, 2000 [DOI: 10.1016/S0257-8972(00)00868-9] | Löffler, Frank |
Reactive plasma spraying of titanium In: Advanced engineering materials, 2 (5), 281-284, 2000 [DOI: 10.1002/(SICI)1527-2648(200005)2:5<281::AID-ADEM281>3.3.CO;2-T] | Lugscheider, Erich Zhao, Lidong Fischer, Andreas |
Benetzbarkeit von PVD-Werkstoffverbunden durch Schmierstoffe In: Tribologie und Schmierungstechnik, 48 (2), 2000 | Lugscheider, Erich Bobzin, Kirsten |
Tool coating deposited by PVD-processes for the protection against corrosion and wear of the aluminium thixoforming-process In: Thin solid films, 377/378, 2000 | Lugscheider, Erich Knotek, Otto Wolff, C. Bärwulf, Stephan |
Brazing of silicon nitride with reactive filler metals In: Science and engineering of composite materials, 7 (3), 107-112, 2000 | Lugscheider, Erich Buschke, I. Indacochea, J. E. Tillmann, W. Trehan, V. Trickey, S. |
On the oxidation of Ni-23Co-17Cr-12Al-0.5Y-Alloy serving as bond coat in thermal barrier coatings In: High temperature material processes, 4 (3), 339-350, 2000 | Haugsrud, R. Kvernes, I. Lugscheider, Erich |
PVD-Dünnschichttechnologie für maßgeschneiderte Oberflächen In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 91 (9), 2580-2585, 2000 | Lugscheider, Erich Bobzin, Kirsten Bärwulf, Stephan |
Rockwell-Härteprüfmaschinen kalibrieren In: Materialprüfung : MP, 42, 2000 | Löffler, F. |
Lotlegierungen und Lötverfahren zum flussmittelfreien Löten schwer benetzbarer Werkstoffe In: Schweissen und Schneiden, 52 (8), 454-460, 2000 | Hillen, Frank Pickart-Castillo, Darmar Rass, I. J. Lugscheider, Erich |
Simulation of heat transfer and residual stresses in plasma spray coating In: News of Belarusian Academy of Science / Series of physic-technical science, 2000 (1), 134-141, 2000 | Kuzmenkov, A. Kundas, S. Gurevich, V. Lugscheider, Erich Eritt, U. |
Computer modelling of the plasma spraying process In: The Paton welding journal, 12, 40-51, 2000 | Lugscheider, Erich Eritt, U. Krivtsun, I. V. Muzhichenko, A. F. Yu, S. |
Feinbleche aus verzinktem Stahl ohne Flussmittel hartlöten In: Der Praktiker, 52 (3), 94-96, 2000 | Lugscheider, Erich Schlimbach, K. |
Durch Pulver-Plasmaauftragschweißen Verschleißverhalten von Aluminiumlegierungen verbessern In: Der Praktiker, 52 (4), 142-146, 2000 | Lugscheider, Erich Dilthey, Ulrich Kabatnik, Lars Langer, G. Schlimbach, K. |
PVD hard coatings protecting the surface of thixoforming tools In: Advanced engineering materials, 2 (1/2), 33-37, 2000 [DOI: 10.1002/(SICI)1527-2648(200002)2:1/2<33::AID-ADEM33>3.0.CO;2-J] | Lugscheider, Erich Bobzin, Kirsten Bärwulf, Stephan Hornig, T. |
Durch Pulver-Plasmaauftragschweißen Verschleißverhalten von Aluminiumlegierungen verbessert In: Der Praktiker, 52 (4), 142-148, 2000 | Dilthey, Ulrich Kabatnik, Lars Lugscheider, Erich Schlimbach, K. |
Tribological properties, phase generation and high temperature phase stability of tungsten- and vanadium-oxides deposited by reactive MSIP-PVD process for innovative lubrication applications In: Surface & coatings technology, 133/134 (1/3), 362-368, 2000 [DOI: 10.1016/S0257-8972(00)00963-4] | Lugscheider, Erich Knotek, Otto Bobzin, Kirsten Bärwulf, Stephan |
Oxidation characteristics and surface energy of chromium-based hardcoatings for use in semisolid forming tools In: Surface & coatings technology, 133/134, 540-547, 2000 | Lugscheider, Erich Bobzin, Kirsten Bärwulf, Stephan Hornig, T. |
Möglichkeiten zur Steigerung der Oberflächenfestigkeit bei Aluminiumlegierungen mit Plasma-Pulver-Schweißverfahren In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 30 (11), 697-702, 1999 [DOI: 10.1002/(SICI)1521-4052(199911)30:11<697::AID-MAWE697>3.3.CO;2-D] | Dilthey, Ulrich Kabatnik, Lars Lugscheider, Erich Schlimbach, K. Langer, G. |
Investigation of the mechanical and structural properties of Ti-Hf-C-N are PVD coatings In: Surface & coatings technology, 116, 239-243, 1999 [DOI: 10.1016/S0257-8972(99)00115-2] | Lugscheider, E. Knotek, O. Zimmermann, H. Hellmann, S. |
Magnetron sputtered titanium nitride thin films on thermoplastic polymers In: Surface & coatings technology, 116, 1172-1178, 1999 [DOI: 10.1016/S0257-8972(99)00157-7] | Lugscheider, E. Bärwulf, S. Riester, M. Hilgers, H. |
Effect of thermal aging on the erosion resistance of air plasma sprayes zirconia thermal barrier coating In: Surface & coatings technology, 113 (3), 278-285, 1999 [DOI: 10.1016/S0257-8972(99)00002-X] | Lugscheider, Erich Remer, P. Janos, B. Z. |
Superhard PVD coatings in the B-N-C triangle In: International journal of refractory and hard metals : R & HM, 17 (1/3), 157-162, 1999 [DOI: 10.1016/S0263-4368(98)00066-3] | Lugscheider, Erich Knotek, Otto Syri, C. W. |
Simulation of the film growth and film-substrate mixing during the sputter deposition process In: Surface & coatings technology, 116/119, 568-572, 1999 | Lugscheider, Erich Hayn, G. v. |
Morphology of sputtered titanium nitride thin films on thermoplastic polymers In: Surface & coatings technology, 116/119, 1001-1005, 1999 | Lugscheider, Erich Riester, M. Bärwulf, Stephan Hilgers, H. |
PVD-hard coated reamers in lubricant - free cutting In: Surface & coatings technology, 112, 146-151, 1999 [DOI: 10.1016/S0257-8972(98)00775-0] | Lugscheider, Erich Knotek, Otto Barimani, Cyrus Leyendecker, T. Lemmer, O. Wenke, R. Wenke, R. |
Properties of tungsten and vanadium oxides deposited by MSIP-PVD process for self-lubricating applications In: Surface & coatings technology, 120/121, 458-464, 1999 | Lugscheider, Erich Barimani, Cyrus Bärwulf, Stephan |
Magnetron sputtered titanium nitride thin films on thermoplastic polymeres In: Surface & coatings technology, 116/119, 1172-1178, 1999 | Lugscheider, Erich Bärwulf, Stephan Riester, M. Hilgers, H. |
Entwicklung einer Technologie zum flußmittelfreien Löten verzinkten Stahls In: Schweissen und Schneiden, 52 (4), 1999 | Lugscheider, Erich Schlimbach, K. |
Optical emission spectroscopy studies of titanium nitride sputtering on thermoplastic polymers In: Surface & coatings technology, 116/119, 981-985, 1999 [DOI: 10.1016/S0257-8972(99)00214-5] | Lugscheider, Erich Neuhäuser, M. Bärwulf, Stephan Hilgers, H. Riester, M. |
Composition of the interface region of sputtered titanium nitride thin films on thermoplastic polymers In: Surface & coatings technology, 116/119, 1179-1182, 1999 | Lugscheider, Erich Riester, M. Bärwulf, Stephan Hilgers, H. |
Investigation of the mechanical and structural properties of Ti-Hf-C-N arc PVD coatings In: Surface & coatings technology, 116/119, 1999 | Lugscheider, Erich Knotek, Otto Zimmermann, H. Hellmann, S. |
Synthetische Ester und PVD-beschichtete Bauteile als Elemente umweltverträglicher Tribosysteme In: Tribologie und Schmierungstechnik, 46 (10), 1999 | Murrenhoff, Hubertus Remmelmann, Andreas Lugscheider, Erich Bobzin, Kirsten |
Investigations of the mechanical and structural properties of Ti-Hf-C-N Arc PVD coatings In: Surface & coatings technology, 116/119, 239-243, 1999 | Lugscheider, Erich Knotek, Otto Zimmermann, H. Hellmann, S. |
Herstellung und Eigenschaftsbestimmung dünner Auftraglotschichten In: Schweissen und Schneiden, 51 (5), 1999 | Lugscheider, Erich |
Structure and properties of PVD-coatings by means of impact tester In: Surface & coatings technology, 116/119, 141-146, 1999 | Lugscheider, Erich Knotek, Otto Wolff, C. Bärwulf, Stephan |
The effect of PVD layer constitution on surface free energy In: Thin solid films, 355/356 (1), 367-373, 1999 [DOI: 10.1016/S0040-6090(99)00543-X] | Lugscheider, Erich Bobzin, Kirsten Möller, M. |
Parameter studies on high-velocity oxy-fuel spraying of MCrAlY coatings In: Surface & coatings technology, 108 (1/3), 16-23, 1998 [DOI: 10.1016/S0257-8972(98)00630-6] | Lugscheider, Erich Herbst-Dederichs, Christian Zhao, Lidong |
Corrosion tests of PVD coatings with die lubricant used for Al high-pressure die-casting dies In: Surface & coatings technology, 108 (1/3), 408-412, 1998 [DOI: 10.1016/S0257-8972(98)00624-0] | Lugscheider, E. Barimani, C. Guerreiro, S. Bobzin, Kirsten |
Beschichtungen lassen Werkzeuge kalt In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 29 (9), 525-536, 1998 [DOI: 10.1002/mawe.19980290911] | Lugscheider, E. Knotek, O. Konig, W. Stock, H. R. Hellman, S. Zimmermann, H. Lake, M. K. Fritsch, R. Seidel, F. |
Innenbeschichtung von Al-Motorblöcken mittels PVD-Technik In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 29 (12), 720-725, 1998 [DOI: 10.1002/mawe.19980291207] | Lugscheider, E. Wolff, C. |
Plasma-Pulverauftragschweißen - Vergleich von Standard- und Hochleistungsprozeß In: Schweissen und Schneiden, 50 (2), 96-101, 1998 | Lugscheider, Erich Langer, G. |
Simulation von Gleitverschleiß In: Metall, 52, 643-651, 1998 | Peterseim, J. Elsing, R. Deuerler, F. |
Das Interview In: Schweissen und Schneiden, 50, 332-333, 1998 | Lugscheider, E. |
Parameter studies on high-velocity oxy-fuel spraying of MCrAIY coatings In: Thin solid films, ..., 1998 | Lugscheider, E. Zhao, Lidong Herbst, C. |
Parameter studies on high-velocity oxy-fuel spraying of MCrAIY coatings In: Surface & coatings technology, 108/109, 16-23, 1998 | Lugscheider, E. Zhao, Lidong Herbst, C. |
Magnetronsputtered hard material coatings on thermoplastic polymers for clean room applications In: Thin solid films, ..., 1998 | Lugscheider, Erich Bärwulf, Stephan Barimani, Cyrus Riester, M. Hilgers, H. |
Investigation of new arc PVD coatings in the system Ti-Hf-C-N In: Thin solid films, ..., 145-145, 1998 | Lugscheider, E. Knotek, O. Zimmermann, H. Stricker, S. |
Corrosion tests of PVD coatings with die dressing used for Al high-pressure die-casting dies In: Thin solid films, ..., 1998 | Lugscheider, Erich Barimani, Cyrus Guerreiro, S. Bobzin, Kirsten |
Vergleich verschiedener Meßmethoden zur Bestimmung der Partikelgröße von Pulvern zum Plasmaspritzen In: Schweissen und Schneiden, 50, 724-731, 1998 | Lugscheider, E. Suk, H.-G. Lee, H.-K. |
Beschichtungstechnologien entwickeln sich mit den Anforderungen: Über den Masseneinsatz entscheidet ein konsequent durchgeführtes Qualitätsmanagement In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 7 (2), 12-13, 1998 | Lugscheider, E. |
Analysis of a-BxCy:Hz coatings with IBA techniques In: Nuclear instruments & methods in physics research / Section B, Beam interactions with materials and atoms, 136/138, 258-262, 1998 | Lugscheider, Erich Giorginis, G. Persson, L. Hult, M. Siry, C. W. Crametz, A. |
Innenbeschichtung von Aluminium Motorblöcken mittels PVD-Technik - Teil 1 In: Galvanotechnik : älteste Fachzeitschrift für die Praxis der Oberflächentechnik, 89 (2), 40-42, 1998 | Lugscheider, Erich Wolff, C. |
Processing, structure and tribological behaviour of TiC-reinforced plasma sprayed coatings In: Wear, 220 (1), 34-50, 1998 [DOI: 10.1016/S0043-1648(98)00237-3] | Economou, S. de Bonte, Marc Celis, Jean-Pierre Smith, R. W. Lugscheider, Erich |
Plasma-arc powder surfacing - comparison of standard and high-productivity processes In: Schweissen und Schneiden, 50, E28-E31, 1998 | Lugscheider, Erich Langer, G. |
Wie High-Tech Beschichtungen laufen lernen : Oberflächenmodifikation an Bauteilen für die Medizintechnik In: RWTH-Themen : Berichte aus der Rheinisch-Westfälischen Technischen Hochschule Aachen, 1998, 40-42, 1998 | Kyeck, Sascha Lake, Mark Lugscheider, Erich |
High-speed flame-sprayed chromium coatings for wear and corrosion protection In: Schweissen und Schneiden, 50, E36-E39, 1998 | Lugscheider, Erich Reymann, H. |
Ceramic thermal barrier coatings deposited with the electron beam-physical vapour deposition technique In: Surface & coatings technology, 98 (1/3), 1221-1227, 1998 | Lugscheider, Erich Barimani, Cyrus Döpper, G. |
Hochgeschwindigkeitsflammgespritzte Chromschichten zum Verschleiß- und Korrosionsschutz In: Schweissen und Schneiden, 50 (1), 44-47, 1998 | Lugscheider, Erich Reymann, H. |
Possibilities and limits of the characterization of wear resistant PVD coatings by photothermal spectroscopy In: Surface & coatings technology, 98 (1/3), 971-975, 1998 [DOI: 10.1016/S0257-8972(97)00308-3] | Hayn, G. v. Knotek, O. Lugscheider, Erich Zimmermann, H. Zimmermann, H. |
(Cr:Al)N coatings deposited by cathodic vacuum ARC evaporation In: Surface & coatings technology, 98 (1/3), 1233-1239, 1998 [DOI: 10.1016/S0257-8972(97)00238-7] | Lugscheider, Erich Vetter, J. Guerreiro, S. |
Heat-resistant active brazing of silicon-nitride. Part 2: Metallurgical characterization of the braze joints In: Welding journal, 77 (Suppl.), 103-109, 1998 | Lugscheider, Erich Tillmann, W. Schlimbach, K. Manter, C. Indacochea, C. A. |
Comparison of different measuring methods for the determination of the particle size of powders for plasma spraying In: Schweissen und Schneiden, 50, E219-E222, 1998 | Lugscheider, Erich Suk, H.-G. Lee, H.-K. |
On the thermoelectric performance of plasma spray-formed iron disilicide In: Journal of materials science / Letters, 17, 1487-1490, 1998 | Lugscheider, Erich Schilz, J. Müller, E. Schakenberg, K. Ernst, H. Kaysser, W. A. Langer, G. |
Wear and cutting performance of coated microdrills In: Surface & coatings technology, 107, 191-196, 1998 | Löffler, F. |
Corrosion tests of PVD coatings with die dressing used for Al high-pressure die-casting dies In: Surface & coatings technology, 108/109, 408-412, 1998 | Lugscheider, Erich Barimani, Cyrus Guerreiro, S. Bobzin, Kirsten |
Magnetron-sputtered hard material coatings on thermoplastic polymers for clean room applications In: Surface & coatings technology, 108/109, 398-402, 1998 | Lugscheider, Erich Bärwulf, Stephan Barimani, Cyrus Riester, C. Hilgers, H. |
Investigations on hard coated reamers in different lubricant free cutting operations In: Surface & coatings technology, 90 (1/2), 172-177, 1997 [DOI: 10.1016/S0257-8972(96)03114-3] | Lugscheider, Erich Knotek, O. Barimani, C. Leyendecker, T. Lemmer, O. Wenke, R. |
Induktives Auftragslöten von Verschleißschutzschichtenim kontinuierlichn Verfahrbetrieb In: Schweissen und Schneiden, 49 (6), 356-358, 1997 | Lugscheider, Erich Schmoor, H. |
Heat-resistant active brazing of silicon-nitride. P. 1: Mechanical evaluation of braze joints - a new class of palladium-based filler metals that wet to ceramics is tested for joint strenght and oxidation resistance In: Welding journal, 76 (8), 300-304, 1997 | Tillmann, W. Schlimbach, K. Manter, C. Indacochea, J. E. Lugscheider, Erich |
PVD coatings for lubricant-free tribological applications In: Wear, 209, 101-105, 1997 | Knotek, O. Lugscheider, Erich Barimani, Cyrus Möller, M. |
Development and characterization of joining techniques for dispersion-strenghtened alumina In: Welding journal, 76 (9), 349-355, 1997 | Lugscheider, Erich Burger, W. Broich, U. |
Fügen und Beschichten in der Produktion der Zukunft - Untersuchung von acht deutschen Forschungsinstituten innerhalb des Rahmenprojekts Produktion 2000 In: Der Praktiker, 49 (11), 516-520, 1997 | Lugscheider, Erich Kortenbruck, G. von Hofe, D. |
Structure and properties of PVD TiB2-Coatings In: Journal of solid state chemistry, 133, 117-121, 1997 | Knotek, Otto Lugscheider, Erich Barimani, Cyrus Möller, M. |
New materials increase applications for brazing - P.I: Process considerations, P.II: Industrial heating In: The journal of thermal technology, 1997, Dez.-Dez., 1997 | Smith, R. Lugscheider, Erich |
Continous inductive hard-surface brazing of wear-resisting layers In: Welding and cutting, 49 (6), E93-E95, 1997 | Lugscheider, Erich Schmoor, H. |
Continious inductive hard-surface brazing of wear-resisting layers In: Schweissen und Schneiden, 49 (6), E 93, 1997 | Lugscheider, Erich Schmoor, H. |
Fügen und Beschichten in der Produktion der Zukunft In: Der Praktiker, 49 (11), 516-516, 1997 | Lugscheider, Erich Kortenbruck, G. von Hofe, D. |
Reactive plasma spraying of coatings containing in situ synthezised titanium hard phases In: International journal of refractory and hard metals : R & HM, 15 (5/6), 311-315, 1997 | Lugscheider, Erich Jungklaus, H. Zhao, Lidong Reymann, H. |
Entwicklung und Anwendung von PVD-Schichten zur Verschleißverringerung von Druckgießformen In: Giesserei : die Zeitschrift für Technik, Innovation und Management, 84 (23), 17-23, 1997 | Lugscheider, Erich Barimani, Cyrus Guerreiro, S. |
Tribological properties of B—C thin films deposited by magnetron-sputter-ion plating method In: Surface & coatings technology, 91 (3), 167-173, 1997 [DOI: 10.1016/S0257-8972(96)03105-2] | Lugscheider, Erich Knotek, Otto Siry, C. W. |
Arc PVD-coated cutting tools for modern machining applications In: Thin solid films, 308/309, 1997 | Lugscheider, Erich Knotek, Otto Barimani, Cyrus Zimmermann, H. |
Superstöchiometric PVD carbidic and carbonitridic coatings In: Materials science & engineering / A, Structural materials: properties, microstructure and processing, 109, 1996 | Knotek, O. Lugscheider, Erich Löffler, Frank Bosserhoff, B. |
Flammspritzen mit nachfolgendem Einschmelzen einer NiCrBSi-Legierung auf vergüteten Stählen In: Schweissen und Schneiden, 48 (2), 116-125, 1996 | Matthes, K.-J. Weichbrodt, K.-H. Lanzendörfer, G. Lugscheider, E. Nyland, A. Sicking, R. |
Mechanical properties of high-temperature brazed titanium materials In: International journal of fatigue, 18 (6), 418-418, 1996 | Lugscheider, Erich Broich, U. Weld, J. |
Superstoichiometric PVD carbide coatings In: Materials science & engineering / A, Structural materials: properties, microstructure and processing, 209 (1/2), 394-398, 1996 | Lugscheider, Erich Knotek, Otto Löffler, Frank Bosserhoff, B. Schmitz, S. |
Financiering binnen de EU van onderzoeksprogramma's toegespitst op duitsland In: Materiaalkunde Nieuws, 1996 (4/April), 1996 | Lugscheider, Erich Krugers, J.-P. Ladru, F. |
Kinetic and microstructural aspects of the reaction layer at ceramic/metal braze joints In: Journal of materials science : JMS, 31 (2), 445-452, 1996 | Xu, R. Lugscheider, Erich Indacochea, J. E. Tillmann, W. |
Characterization of thermal sprayed bioactive coatings In: Colloids and surfaces / B, Biointerfaces, 6 (1), 7 S., 1996 | Lugscheider, Erich Knepper, M. Nyland, A. |
PVD coatings for luricant-free tribological applications In: Wear, 209, 101-105, 1996 | Lugscheider, Erich Knotek, Otto Barimani, Cyrus Möller, M. |
Investigation of thermophysical properties of AIP coated cutting tools for dry machining In: Surface & coatings technology, 86/87 (2), 803-808, 1996 | Lugscheider, Erich Geiler, H. D. Lake, M. Zimmermann, H. |
Strength and microstructure of brazed cemented carbide and silicon nitride joints In: Journal of materials processing technology, 58 (1), 13-23, 1996 [DOI: 10.1016/0924-0136(95)02103-5] | Lugscheider, Erich Martens, L. Tillmann, W. Ziegler, G. |
Modeling of the APS plasma spray process In: Computational materials science, 7 (1/2), 109-114, 1996 | Lugscheider, Erich Barimani, Cyrus Eckert, P. Eritt, U. |
Simulation of the deposition process in PVD-technology In: Computational materials science, 7 (1/2), 154-158, 1996 [DOI: 10.1016/S0927-0256(96)00074-2] | Lugscheider, Erich Knotek, Otto Barimani, Cyrus Eckert, P. Hayn, G. |
Sliding wear behaviour of thermally sprayed 75/25 Cr3C2/NiCr wear resistant coatings In: Wear, 198, 251-266, 1996 [DOI: 10.1016/0043-1648(96)06983-9] | Mohanty, M. Smith, R. W. de Bonte, Marc Celis, Jean-Pierre Lugscheider, Erich |
Comparison of the structure of PVD thin films deposited with different deposition energies In: Surface & coatings technology, 86/87 (1), 177-183, 1996 | Lugscheider, Erich Barimani, Cyrus Wolff, C. Guerreiro, S. Döpper, G. |
Wirtschaftlichkeitsanalyse modernener Beschichtungsverfahren anhand ausgewählter Anwendungsbeispiele In: Stahl, 1996 (4), 45-48, 1996 | Lugscheider, Erich May, J. Wulfhorst, B. Gries, T. Bärwulf, Stephan Bosserhoff, B. |
Simulation von Strahlverschleiß In: Metall, 50 (11), 713-722, 1996 | Petersheim, J. Elsing, Rainer |
Effect of single impact damage on strength of alumina and zirconia-toughened alumina In: Journal of materials science / Letters, 15, 1925-1926, 1996 | Lugscheider, Erich Huang, Xingija Tu, Mingjing |
Das Reib- und Verschleißverhalten von ungeschmierten Ti-Al-C-N-PVD-Schichten In: Tribologie und Schmierungstechnik, 43 (2), 1996 | Lugscheider, Erich Löffler, Frank Wolff, C. |
Kriterien für die Auswahl von Beschichtungsverfahren In: VDI-Z integrierte Produktion, 138 (1/2), 36-41, 1996 | Nyland, A. Kron, P. B. Ellermeier, J. Schierling, M. |
Deposition of arc TiAlN coatings with pulsed bias In: Surface & coatings technology, 76-77 (Part 2), 700-705, 1995 [DOI: 10.1016/02578-9729(68)00090-] | Lugscheider, E. Knotek, O. Loffler, F. Barimani, C. Guerreiro, S. Zimmermann, H. |
Einsatz von Zwischenschichten zum Abbau von Spannungen in aktivgelöteten Siliciumnitrid-Stahl-Verbindungen In: Schweissen und Schneiden, 47 (2), 97-107, 1995 | Lugscheider, Erich Tillmann, W. Maier, H. R. Magin, Michael |
Einsatz von PVD-Beschichtungen zur Minimierung von Kühlschmierstoffen bei der Zerspanung In: VDI-Z integrierte Produktion / Special, 1995, 1995 | Lugscheider, Erich Löffler, Frank Barimani, Cyrus Zimmermann, H. |
Eigenschaften hart- und hochtemperaturgelöteter Titanverbindungen In: Schweissen und Schneiden, 47, 197-205, 1995 | Lugscheider, Erich Broich, U. Steffens, H.-D. Ashoff, D. |
Design of wear resistant NiCr-TiC plasma sprayed coatings based on modifications in the carbide and the binder phase In: Wear, 185, 1995 | Economou, S. de Bonte, Marc Celis, Jean-Pierre Smith, R. W. Lugscheider, Erich |
Wirtschaftlichkeitsanalyse neuer Beschichtungstechnologien In: VDI-Z integrierte Produktion, 137 (7//8), 42-46, 1995 | Lugscheider, Erich Gries, Thomas Wulfhorst, Burkhard May, Johannes Bosserhoff, Bert Hans |
PVD-Beschichtungen contra Kühlschmierstoff-Verbrauch In: VDI-Z integrierte Produktion / Special, 1995 (4), 38-42, 1995 | Lugscheider, Erich Löffler, Frank Barimani, Cyrus Zimmermann, H. |
Plasmaspritzen von Titanhartstoffen : Neue Möglichkeiten zum Verschleißschutz In: Schweissen und Schneiden, 47, 822-831, 1995 | Lugscheider, Erich Jungklaus, H. Wielage, B. Henker, A. |
Heat resistant active brazing of silicon-nitride : P. 1: Mechanical evaluation of braze joints In: Welding journal, 74, 1995 | Lugscheider, Erich Tillmann, W. Schlimbach, K. Manter, C. Indacochea, J. E. |
Thick thermal barrier coatings for Diesel engines In: Surface engineering, 11 (4), 1995 | Lugscheider, Erich Kvernes, I. |
Thermal sprayed aluminium-silicon alloy coatings In: Materials and manufacturing processes, 10, 837-841, 1995 | Lugscheider, Erich Jokiel, P. Feldhege, M. |
Tribological behaviour of TiC/TaC-reinforced cermet plasma sprayed coatings tested against sapphire In: Wear, 185 (1/2), 93-110, 1995 [DOI: 10.1016/0043-1648(95)06597-0] | Economou, S. de Bonte, Marc Celis, Jean-Pierre Roos, J. R. Smith, R. W. Lugscheider, Erich Valencic, A. |
Arc-evaporation of multicomponent MCrAlY cathodes In: Surface & coatings technology, 74/75, 118-122, 1995 | Lugscheider, Erich Knotek, Otto Löffler, F. Beele, W. Barimani, Cyrus |
Deposition of arc-TiAIN coatings with pulsed bias In: Surface & coatings technology, 76/77, 700-705, 1995 | Lugscheider, Erich Knotek, Otto Löffler, Frank Barimani, Cyrus Guerreiro, S. Zimmermann, H. |
Steigerung der Warmfestigkeit der Bindephase von Cermets In: Metall, 49, 326-336, 1995 | Grewe, H. Kolaska, H. |
Entwicklung von hochtemperaturbeständigen Aktivlötverbindungen aus Nichtoxidkeramik In: Metall, 48 (1), 27-33, 1994 | Lugscheider, Erich Tillmann, Walter Weise, W. |
The wear behaviour of heat-treated PVD coatings In: Surface & coatings technology, 68, 199-202, 1994 [DOI: 10.1016/0257-8972(94)90160-0] | Knotek, O. Löffler, F. Wolff, C. Wolkers, L. |
Behaviour of CVD and PVD coatings under impact load In: Surface & coatings technology, 68/69, 253-258, 1994 [DOI: 10.1016/0257-8972(94)90170-8] | Knotek, O. Lugscheider, E. Löffler, F. Schrey, A. Bosserhoff, B. |
Plasma spraying of high-nitrogen-bearing steels for wear-resistant coatings and structural applications In: Journal of materials engineering and performance, 3 (4), 476-483, 1994 [DOI: 10.1007/BF02645313] | Khatri, S. Smith, R. Jokiel, P. Lugscheider, E. Bohley, M. |
TiO2 - PVD. Sputtertemperatur und Haftfestigkeit In: Metalloberfläche : mo, 48, 40-45, 1994 | Pyun, S.-I. Yoon, Y.-G. Hyun, S.-M. Lugscheider, E. Mathesius, R. |
Verbesserung der Eigenschaften von Hartlegierungen durch auftraggeschweißte carbidische Verbundpulver In: Schweissen und Schneiden, 46, 109-114, 1994 | Lugscheider, E. Ait-Mekideche, Azedine Melzer, A. |
Phase-relations in the c-cr-fe system in the vicinity of the (liquid+bcc+m23c6+m7c3) invariant equilibrium - experimental determinations and thermodynamic modeling In: Zeitschrift für Metallkunde, 85 (5), 359-364, 1994 | Kowalski, M. Spencer, P. J. Granat, K. Drzeniek, H. Lugscheider, E. |
Subsequent sealing of thermally sprayed coatings to increase corrosion resistance In: Surface engineering, 10, 46-51, 1994 | Lugscheider, E. Jokiel, P. Messerschmidt, V. Beckschulte, G. |
Technologische Eigenschaften von Breitspaltlötverbindungen an Rohren In: Schweissen und Schneiden, 46, 274-276, 1994 | Lugscheider, E. Schmoor, H. |
Einsetzbarkeit gelöteter Chrom-Nickel-Stähle in Wässern In: Der Praktiker, 46, 228-230, 1994 | Brandl, W. Steffens, H.-D. Rukzinski, D. Podleschny, R. Lugscheider, E. Minarski, P. |
Neuartige Schweißzusatzwerkstoffe auf Fe-W-Ti-C-Basis gegen mineralischen Abrasivverschleiß In: Braunkohle, Tagebautechnik - Neue Bergbautechnik, 45, 24-28, 1994 | Lugscheider, Erich Reymann, H. |
Kupferbasis-Reaktionslote. Ein Lösungsweg zum Löten poröser Sinterstähle In: Schweissen und Schneiden, 46, 425-429, 1994 | Lugscheider, E. Tillmann, W. Feng, M. E. Z. |
Zur Ausbildung von Reaktionsschichten bei aktivgelöteten nichtoxidischen Ingenieurkeramiken. T. 1: Grundlagen und Wechselwirkung zwischen Aktivmetallen und Siliciumnitrid In: VTE : Aufbau- und Verbindungstechnik in der Elektronik, 1994, 156-162, 1994 | Tillmann, W. Lugscheider, E. Gale, W. F. |
Zur Ausbildung von Reaktionsschichten bei aktivgelöteten nichtoxidischen Ingenieurkeramiken. T. 2: Wechselwirkung zwischen Aktivmetallen und Siliciumcarbid sowie Aluminiumnitrid In: VTE : Aufbau- und Verbindungstechnik in der Elektronik, 1994, 210-212, 1994 | Tillmann, W. Lugscheider, E. Gale, W. F. |
Möglichkeiten des stoffschlüssigen Fügens metallischer Verbundwerkstoffe. Eine Übersicht In: Schweissen und Schneiden, 46, 543-549, 1994 | Tillmann, W. Lugscheider, E. |
Cytotoxicity investigations of plasma sprayed calcium phosphate coatings In: Journal of materials science / Materials in medicine, 5, 371-375, 1994 [DOI: 10.1007/BF00058966] | Lugscheider, E. Knepper, M. Heimberg, B. Dekker, A. Kirkpatrick, C. J. |
Pulvermetallurgie im Wettbewerb In: Met, 48, 899, 1994 | Lugscheider, E. Deiser, C. |
Hochtemperatureigenschaften von MCrAlY(Ti,Hf) beschichtetem Ventilstahl X 45 CrSi 9 3 bei 600 und 700°C In: Materialwissenschaft und Werkstofftechnik = Materials science and engineering technology, 24 (11), 397-403, 1993 [DOI: 10.1002/mawe.19930241110] | Lugscheider, Erich Müller, U. Holdinghausen, A. |
Performance behaviour of physical-vapour-deposition-coated cermets in interrupted-cut machining In: Surface & coatings technology, 62 (1/3), 669-673, 1993 [DOI: 10.1016/0257-8972(93)90316-G] | Knotek, O. Löffler, F. Krämer, G. |
Interessante Anwendungen für das Hochtemperaturlöten In: Jahrbuch Schweißtechnik, 1994, 173-178, 1993 | Lugscheider, E. Tillmann, W. Schmoor, H. |
Plasmaspritzen - Verfahren, Anwendungen, Entwicklungen In: Metall, 47, 230-236, 1993 | Lugscheider, E. Jokiel, P. |
Werkstoff- und Prozeßentwicklung in der Beschichtungstechnik In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 5 (3), 42-45, 1993 | Lugscheider, E. Westermann, U. |
Evaluation of d.c.-plasma jet chemical vapour deposition for diamond coatings on tungsten carbide based cutting plates In: Diamond and related materials, 2 (12), 1464-1466, 1993 [DOI: 10.1016/0925-9635(93)90013-R] | Lugscheider, E. Müller, U. |
Zuverlässiges belastbares Fügeverfahren für Motorenbau und Energietechnik In: Handelsblatt : Deutschlands Wirtschafts- und Finanzzeitung, 63 (31.3.1993), 31, 1993 | Lugscheider, E. Tillmann, W. Weise, W. |
Methods for brazing ceramic and metal-ceramic joints In: Materials and manufacturing processes, 8, 219-238, 1993 | Lugscheider, E. Tillmann, W. |
Braze coat process combines with induction heating for deposition of wear-resistant materials In: Welding journal, 72 (5), 55-59, 1993 | Lugscheider, E. Gundlfinger, K. Schmoor, H. |
Zukunftsweisende Tendenzen im Thermischen Spritzen In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 5 (5/6), 70-72, 1993 | Lugscheider, E. Jokiel, P. |
Titandisilizid - ein korrosionsbeständiger Hochtemperatur-Werkstoff mit metallischen Eigenschaften In: Metall, 47, 741-745, 1993 | Westermann, U. Lugscheider, E. Wonka, J. |
Verarbeitung Cr3C2-verstärkter Nickelhartlegierungen durch das autogene Flammspritzen In: Schweissen und Schneiden, 45, 494-498, 1993 | Lugscheider, E. Jokiel, P. Reimann, H. Heinrich, P. |
Applying Cr3C2-reinforced nickel-based hard alloys by oxyacetylene flame spraying In: Welding and cutting, 1993 (9), E163- E166, 1993 | Lugscheider, E. Jokiel, P. Reimann, H. Heinrich, P. |
Verarbeitung wolframcarbidverstärkter Nickelhartlegierungen durch Flammspritzen In: Schweissen und Schneiden, 45, 601-604, 1993 | Lugscheider, E. Jokiel, P. Karduck, P. Reimann, H. Heinrich, P. |
Arc deposition of Ti-C and Ti-C-N using acetylene as a reactive gas In: Vacuum, 43 (5/7), 645-648, 1992 [DOI: 10.1016/0042-207X(92)90098-H] | Knotek, Otto Löffler, Frank Krämer, G. |
Reproducible arc-PVD process management under various reactive gases In: Vacuum, 43 (5/7), 567-571, 1992 [DOI: 10.1016/0042-207X(92)90079-C] | Knotek, Otto Löffler, Frank Krämer, G. Stössel, C. |
Multicomponent and multilayer physically vapor-deposited coatings for cutting tools In: Surface & coatings technology, 54 (1/3), 241-248, 1992 [DOI: 10.1016/0257-8972(92)90169-B] | Knotek, Otto Löffler, Frank Kramer, G. |
Thermisches Spritzen In: Keramische Zeitschrift, 44 (Beil.), 1-4, 1992 | Eschnauer, H. Lugscheider, E. Müller, U. Weber, T. |
Entwicklung hochvakuumdichter Oxidkeramik-Metall-Lötverbindungen In: Schweissen und Schneiden, 44, 92-96, 1992 | Lugscheider, E. Boretius, M. |
Surface engineering of Diesel engine parts - new technological achievements in powders and coating microstructures In: Powder metallurgy international : PMI, 24, 7-13, 1992 | Kvernes, I. Lugscheider, E. |
Zusatzwerkstoffe zum Metall-Inertgasauftragschweißen In: Schweissen und Schneiden, 44, 138-143, 1992 | Lugscheider, E. Deppe, E. Ambroziak, Andrej Melzer, A. |
Weld filler materials for metal-arc inert gas surface welding In: Welding and cutting, 1992 (3), E 50-E 53, 1992 | Lugscheider, E. Deppe, E. Ambroziak, Andrej Melzer, A. |
Beschichtungen durch Vakuumplasmaspritzen In: Technica : die Fachzeitschrift für die Maschinen-, Elektro- und Metallindustrie, 41 (9), 19-22, 1992 | Lugscheider, E. Born, K. |
Modelling of temperature gradients and stress-strain distributions during the plasma spraying process In: Powder metallurgy international : PMI, 24, 240-245, 1992 | Borgerding, B. Sölter, H.-J. Lugscheider, E. Simhan, K. |
Kristalline Diamantschichten auf Schneidwerkzeugen In: Ingenieur-Werkstoffe : Zeitschrift des Vereins Deutscher Ingenieure für Werkstoffanwendung, Material- und Oberflächentechnologien, Zulieferung, 4 (7/8), 42-44, 1992 | Lugscheider, E. Müller, U. |
High-speed temperature measurement for on-line process control and quality assurance during plasma-spraying In: Powder metallurgy international : PMI, 24, 169-175, 1992 | Sölter, H.-J. Müller, U. Lugscheider, E. |
Optimization of spraying process and laser treatment of CoNiCrA1Y In: Journal of thermal spray technology : JTST, 1, 239-248, 1992 | Lugscheider, E. Hofmann, D. Nicoll, A. R. |
Hochvakuumdichte Keramik-Metall-Lötverbindungen In: Metall, 46, 802-805, 1992 | Lugscheider, E. Boretius, M. |
Comparison of properties of coatings produced by laser cladding and conventional methods In: Journal of materials science & technology : JMST, 8, 657-665, 1992 | Oberländer, B. C. Lugscheider, E. |
Fügen von Keramik bei hohen Betriebstemperaturen In: Werkstoff und Innovation, 5 (5/6), 44-48, 1992 | Lugscheider, E. Tillmann, W. |
Production of spherical powders - the first step for optimized thermal-sprayed apatite coatings In: Journal of thermal spray technology : JTST, 1, 215-221, 1992 | Lugscheider, E. Knepper, M. Gross, K. A. |
Underwater plasma processing of stabilized zirconia for thermal barrier coatings In: Journal of thermal spray technology : JTST, 1, 49-55, 1992 | Lugscheider, E. Rass, I. |
Metallographische Präparation plasmagespritzter Borcarbid-Schichten In: Praktische Metallographie = Practical metallography, 23, 501-512, 1992 | Lugscheider, E. Koch, D. Limbach, R. |
The development of high vacuum-tight oxide ceramic-metal brazed joints In: Welding and cutting, 1992 (2), E 37-E 40, 1992 | Lugscheider, E. Boretius, M. |
Properties of arc-evaporated crn and (cr, al)n coatings In: Surface & coatings technology, 45 (1/3), 53-58, 1991 [DOI: 10.1016/0257-8972(91)90205-B] | Knotek, Otto Löffler, Frank Scholl, H. J. |
On the origin of compressive stress in PVD coatings : an explicative model In: Surface & coatings technology, 46 (3), 265-274, 1991 [DOI: 10.1016/0257-8972(91)90169-W] | Knotek, Otto Elsing, Rainer Krämer, G. Jungblut, F. |
Ti(c,n) coatings using the arc process In: Surface & coatings technology, 46 (1), 39-46, 1991 [DOI: 10.1016/0257-8972(91)90148-P] | Ertürk, E. Knotek, Otto Burgmer, W. Prengel, H.-G. Heuvel, H. J. Dederichs, H. G. Stossel, C. |
Magnetron-sputtered superhard coatings within the system Ti-B-C-N In: Vacuum, 41 (7/9), 2184-2186, 1990 [DOI: 10.1016/0042-207X(90)94220-K] | Knotek, O. Jungblut, F. Breidenbach, R. |
Untersuchungen zur Korrosionsbeständigkeit hochtemperaturgelöteter Werkstoffe in Trinkwasser In: Schweissen und Schneiden, 41, 590-595, 1989 | Lugscheider, E. Minarski, P. |
Werkstoffkundliche Untersuchungen zum Löten verschiedener orthodontischer Drähte In: Journal of orofacial orthopedics, 50, 506-517, 1989 | Hannemann, M. Minarski, P. Lugscheider, E. Diedrich, P. |
Entwicklung und Optimierung von Eisen-Chrom-Bor-Kohlenstoff-Legierungen für das Metallichtbogenschweißen von Hartauftragungen mit Fülldrahtelektroden In: Schweissen und Schneiden, 41, 661-666, 1989 | Drzeniek, H. Granat, K. Li, Z. Lugscheider, E. |
Erosionsverhalten von Nickelbasisloten beim Hochtemperaturlöten In: Schweissen und Schneiden, 41, 342-345, 1989 | Lugscheider, E. Cosack, T. |
Oberflächenvorbehandlung schwer benetzbarer metallischer Werkstoffe In: Schweissen und Schneiden, 41, 221-225, 1989 | Lugscheider, E. Minarski, P. |
Unterwasserplasmaspritzen - eine neue Verfahrensvariante In: Schweissen und Schneiden, 41, 547-550, 1989 | Lugscheider, E. Bugsel, B. |
Erosionsverhalten von Nickelbasisloten beim Hochtemperaturlöten In: Schweissen und Schneiden, 41, 342-345, 1989 | Lugscheider, E. Cosack, T. |
Laserunterstützte Beschichtungstechnologie - Verwirklichung neuer Werkstoffzustände mit dem Hochleistungslaser In: Schweissen und Schneiden, 40 (9), 1988 | Lugscheider, E. |
Fügen von Hochleistungskeramik untereinander und mit Metall In: Technische Mitteilungen : TM, 80 (4), 1987 | Lugscheider, Erich Krappitz, Harald Boretius, M. |
Stand und Entwicklungstendenzen beim Plasmaspritzen In: Elektrowärme international : ewi, 45, B 190-B 195, 1987 | Lugscheider, Erich Weber, Thomas |
Überwältigendes Anwendungspotential. Plasmaspritzen von Verschleiss- schutzschichten In: Industrie-Anzeiger, 109 (83), 1987 | Lugscheider, Erich |